PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01015223001
Common NameLOC100247499, VIT_11s0016g02410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 298aa    MW: 32415.7 Da    PI: 10.0443
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01015223001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-14103147347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  GSVIVT01015223001 103 PWTEEEHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 147
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.55696152IPR017930Myb domain
SuperFamilySSF466891.22E-1797152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1899151IPR006447Myb domain, plants
SMARTSM007172.2E-11100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-12100146IPR009057Homeodomain-like
CDDcd001677.97E-10103148No hitNo description
PfamPF002498.6E-12103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence