PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01014276001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 450aa    MW: 51159.2 Da    PI: 5.613
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01014276001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.44.4e-171064256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +++ ++t++q++ Le+ F   +++  e++ +LA++lg++ rqV +W+qN+Ra++k
  GSVIVT01014276001 10 KHKKRLTQDQVRLLETSFDHGKKLEPERKLHLARELGVPPRQVAIWYQNKRARWK 64
                       67889*************************************************9 PP

2HD-ZIP_I/II106.42.1e-3411102293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +k+rl+++qv+lLE+sF++ +kLeperK +lareLg+ prqva+W+qn+RAR+kt++lE dy++++ ++++   e++rLe++v +L+ el++
  GSVIVT01014276001  11 HKKRLTQDQVRLLETSFDHGKKLEPERKLHLARELGVPPRQVAIWYQNKRARWKTQNLELDYNVIRVRLEHALIEKRRLERDVIRLQGELEK 102
                        79*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.244666IPR001356Homeobox domain
SuperFamilySSF466896.42E-17875IPR009057Homeodomain-like
SMARTSM003897.4E-16870IPR001356Homeobox domain
CDDcd000868.87E-141067No hitNo description
PfamPF000461.9E-141064IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.5E-181273IPR009057Homeodomain-like
PROSITE patternPS0002704164IPR017970Homeobox, conserved site
PfamPF117898.2E-13335397IPR004181Zinc finger, MIZ-type
SuperFamilySSF578501.41E-5350397No hitNo description
Gene3DG3DSA:3.30.40.107.9E-6350394IPR013083Zinc finger, RING/FYVE/PHD-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006974Biological Processcellular response to DNA damage stimulus
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0010082Biological Processregulation of root meristem growth
GO:0016925Biological Processprotein sumoylation
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0045931Biological Processpositive regulation of mitotic cell cycle
GO:0060250Biological Processgerm-line stem-cell niche homeostasis
GO:0080038Biological Processpositive regulation of cytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0008270Molecular Functionzinc ion binding
GO:0019789Molecular FunctionSUMO transferase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MDAFHSQHQK HKKRLTQDQV RLLETSFDHG KKLEPERKLH LARELGVPPR QVAIWYQNKR  60
ARWKTQNLEL DYNVIRVRLE HALIEKRRLE RDVIRLQGEL EKAHEMLHAL NYANPNPPPI  120
VSTVLSSISC DEGGSTLENN EEFQFENLYA SLMGIYGSWA FGLKCKSPFQ VHSGSKRCVS  180
VRFEELEQWR RPPLLLPATM ASPEDSGTPL PLSTPITNLS LLKFRKAMIL MKEVAVDLER  240
DGQSQMVKEL EDAVVELLGT SEDCTQFSAA IQSVGNEHQP RPELTDFKKL FEDEVAKLKA  300
SSSFAPQSHP LLRQFREAVW NVHHAGQPMP GDEQEDIVMT STQCNLLNIT CPLSGRPVTE  360
LADPVRSVDC KHIYEKKAIL HYIKSKHGRA QCPVAACPKI LQAERVVCDA LLQIEIDEMK  420
SMSKQPGRTD VIEDFTELDD DDDEEEEDD*
Functional Description ? help Back to Top
Source Description
UniProtE3 SUMO-protein ligase that modulates cell cycle progression and functions as a repressor of endocycle onset in meristems. May function downstream of the meristem patterning transcription factors PLETHORA 1 and 2 (PLT1 and PLT2) in root meristem development. Modulates the expression of the mitotic cyclins CYCB1-1 and CYCB1-2 and cyclin-dependent kinases CDKB1-1 and CDKB2-1 in root meristem. Involved in cytokinin signaling in root development. {ECO:0000269|PubMed:19666737, ECO:0000269|PubMed:19682286}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4598560.0AM459856.2 Vitis vinifera contig VV78X094534.23, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644170.10.0PREDICTED: E3 SUMO-protein ligase MMS21
SwissprotQ8GYH75e-95NSE2_ARATH; E3 SUMO-protein ligase MMS21
TrEMBLF6H2120.0F6H212_VITVI; Uncharacterized protein
STRINGVIT_19s0014g02100.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.14e-30homeobox protein 52
Publications ? help Back to Top
  1. Lee J, et al.
    Salicylic acid-mediated innate immunity in Arabidopsis is regulated by SIZ1 SUMO E3 ligase.
    Plant J., 2007. 49(1): p. 79-90
    [PMID:17163880]
  2. Huang L, et al.
    The Arabidopsis SUMO E3 ligase AtMMS21, a homologue of NSE2/MMS21, regulates cell proliferation in the root.
    Plant J., 2009. 60(4): p. 666-78
    [PMID:19682286]
  3. Zhang S,Qi Y,Yang C
    Arabidopsis SUMO E3 ligase AtMMS21 regulates root meristem development.
    Plant Signal Behav, 2010. 5(1): p. 53-5
    [PMID:20592809]
  4. Ishida T,Yoshimura M,Miura K,Sugimoto K
    MMS21/HPY2 and SIZ1, two Arabidopsis SUMO E3 ligases, have distinct functions in development.
    PLoS ONE, 2012. 7(10): p. e46897
    [PMID:23056518]
  5. Zhang S,Qi Y,Liu M,Yang C
    SUMO E3 ligase AtMMS21 regulates drought tolerance in Arabidopsis thaliana(F).
    J Integr Plant Biol, 2013. 55(1): p. 83-95
    [PMID:23231763]
  6. Xu P, et al.
    AtMMS21, an SMC5/6 complex subunit, is involved in stem cell niche maintenance and DNA damage responses in Arabidopsis roots.
    Plant Physiol., 2013. 161(4): p. 1755-68
    [PMID:23426194]
  7. Okushima Y,Shimizu K,Ishida T,Sugimoto K,Umeda M
    Differential regulation of B2-type CDK accumulation in Arabidopsis roots.
    Plant Cell Rep., 2014. 33(7): p. 1033-40
    [PMID:24573537]
  8. Yuan D, et al.
    AtMMS21 regulates DNA damage response and homologous recombination repair in Arabidopsis.
    DNA Repair (Amst.), 2014. 21: p. 140-7
    [PMID:24795278]
  9. Liu M, et al.
    SUMO E3 ligase AtMMS21 is required for normal meiosis and gametophyte development in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 153
    [PMID:24893774]
  10. Kwak JS,Son GH,Kim SI,Song JT,Seo HS
    Arabidopsis HIGH PLOIDY2 Sumoylates and Stabilizes Flowering Locus C through Its E3 Ligase Activity.
    Front Plant Sci, 2016. 7: p. 530
    [PMID:27148346]
  11. Liu Y, et al.
    The Arabidopsis SUMO E3 Ligase AtMMS21 Dissociates the E2Fa/DPa Complex in Cell Cycle Regulation.
    Plant Cell, 2016. 28(9): p. 2225-2237
    [PMID:27492969]
  12. Liu L, et al.
    Transcriptional Gene Silencing Maintained by OTS1 SUMO Protease Requires a DNA-Dependent Polymerase V-Dependent Pathway.
    Plant Physiol., 2017. 173(1): p. 655-667
    [PMID:27852949]
  13. Zhang J, et al.
    A SUMO Ligase AtMMS21 Regulates the Stability of the Chromatin Remodeler BRAHMA in Root Development.
    Plant Physiol., 2017. 173(3): p. 1574-1582
    [PMID:28115583]
  14. Yu M, et al.
    A SUMO ligase AtMMS21 regulates activity of the 26S proteasome in root development.
    Plant Sci., 2019. 280: p. 314-320
    [PMID:30824010]