PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01013871001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 186aa    MW: 20906.9 Da    PI: 9.7513
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01013871001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.7e-15105149347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +W++eE+  ++ + ++lG+g+W+ Ia+++ ++Rt+ q+ s+ qky
  GSVIVT01013871001 105 PWSEEEHRTFLAGLEKLGKGDWRGIAKKFVTTRTPTQVASHAQKY 149
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.664722IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.109.4E-4831IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.209100154IPR017930Myb domain
SMARTSM007171.7E-10102152IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-15104152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-12104149IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-17104152IPR006447Myb domain, plants
CDDcd001674.46E-10105150No hitNo description
PfamPF002491.2E-12105149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MVKESVRKCS HCGNNGHNSR TCSAGGKGCL KLFGVQILTE KEDEAMRKSL SMGNLQSCNI  60
EHHHGDAGYL SDGLLQSRRG KQKYIEIGDF SSYEWISVCF CLGVPWSEEE HRTFLAGLEK  120
LGKGDWRGIA KKFVTTRTPT QVASHAQKYF LRRAACDKRK RRPSLFDMPL DPVLLHLSRN  180
RNHLA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4548011e-161AM454801.2 Vitis vinifera contig VV78X076901.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278155.21e-105PREDICTED: transcription factor MYB1R1 isoform X1
SwissprotQ9FKF93e-52M5162_ARATH; Probable transcription factor At5g61620
TrEMBLA0A438INP81e-104A0A438INP8_VITVI; Putative transcription factor
STRINGXP_008234449.11e-65(Prunus mume)
STRINGXP_010258761.17e-66(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-54MYB_related family protein
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]