PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01013631001
Common NameLOC100261516, VIT_00s0125g00290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 176aa    MW: 19180.8 Da    PI: 7.8959
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01013631001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.38.6e-46131121100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp e+r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l++
  GSVIVT01013631001  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPVEQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDLLQT 104
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +lal+++e
  GSVIVT01013631001 105 QLALAQAE 112
                        ***99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7112113IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MKESSRKQGA ASPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQE  60
LPVEQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID LLQTQLALAQ AEVVHLRVRQ  120
AASLSTTRHP ISPSNSTASP SPSSNFMPPS HTKPFFEMDM VVDHDSLGES VWYPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-5091267124LOB family transfactor Ramosa2.1
5ly0_B5e-5091267124LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4443030.0AM444303.2 Vitis vinifera contig VV78X107337.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270650.11e-128PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE97e-79LBD4_ARATH; LOB domain-containing protein 4
TrEMBLE0CTA11e-127E0CTA1_VITVI; Uncharacterized protein
STRINGVIT_00s0125g00290.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-72LOB domain-containing protein 4