PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01013073001
Common NameLOC100253940, VIT_02s0012g02030, VITISV_032685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 799aa    MW: 88376.2 Da    PI: 5.9103
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01013073001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2087142156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t+ q++e+e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  GSVIVT01013073001  87 KKRYHRHTARQIQEMEALFKECPHPDDKQRMKLSQELGLKPRQVKFWFQNRRTQMK 142
                        688899***********************************************998 PP

2START169.22.7e-532855092206
                        HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
              START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                        la +  +elvk+ +++ep+W +s   eng+ev+  +e ++              +++ea r+s+vv+m++ +lv  +ld + +W e ++   
  GSVIVT01013073001 285 LAISSVDELVKMCQLGEPLWIRSN--ENGKEVINVEEYGRMfpwpmnlkqhpgeFRTEATRDSAVVIMNSINLVDAFLDAM-KWMELFPsii 373
                        6778899*****************..**********99999****************************************.********** PP

                        .EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
              START  78 .kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                         +a+t++v+s       g l+lm+aelq+lsplvp R+  f+Ry++q   +g+w+ivd  +ds +++  ++sv R +++pSg++i++++ng+
  GSVIVT01013073001 374 sRAKTVQVLSGVsghanGSLHLMYAELQVLSPLVPtRETHFLRYCQQnVDEGTWAIVDFPIDSFNDNL-QPSVPRYRRRPSGCIIQDMPNGY 464
                        *********97777999******************************9999***************98.9********************** PP

                        EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        s+vtwveh+d++++ +h +++++v+sg+a+ga +w+a lqrqce+
  GSVIVT01013073001 465 SRVTWVEHADVEEKPVHHIFHHFVNSGMAFGATRWLAVLQRQCER 509
                        *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-2175138IPR009057Homeodomain-like
SuperFamilySSF466897.52E-2075145IPR009057Homeodomain-like
PROSITE profilePS5007117.21684144IPR001356Homeobox domain
SMARTSM003892.1E-1985148IPR001356Homeobox domain
PfamPF000465.0E-1887142IPR001356Homeobox domain
CDDcd000864.35E-1987145No hitNo description
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PROSITE profilePS5084846.877275512IPR002913START domain
SuperFamilySSF559611.65E-35276511No hitNo description
CDDcd088753.52E-125279508No hitNo description
SMARTSM002343.0E-41284509IPR002913START domain
PfamPF018523.5E-45285509IPR002913START domain
Gene3DG3DSA:3.30.530.206.4E-6373504IPR023393START-like domain
SuperFamilySSF559611.24E-16548771No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MYGDCQVLTS MGGNVVSSDS LFSSPIRNPN FNFMSSMGGP FHAFSSIIPK EESGLLRGKD  60
EMESGSGSEH IEGVSGNEQE NEQQPKKKRY HRHTARQIQE MEALFKECPH PDDKQRMKLS  120
QELGLKPRQV KFWFQNRRTQ MKAQQDRSDN VILRAENENL KNENYRLQAA LRSVICPNCG  180
GPAMLGEIAF DEQQLRIENA RLKEELDRVC CLASRYGGRA IQAIGPPPPL LAPSLDLDMS  240
IYARNFPEPM ANCTDMIPVP LMPESSHFPE GGLVLEEEKS LALELAISSV DELVKMCQLG  300
EPLWIRSNEN GKEVINVEEY GRMFPWPMNL KQHPGEFRTE ATRDSAVVIM NSINLVDAFL  360
DAMKWMELFP SIISRAKTVQ VLSGVSGHAN GSLHLMYAEL QVLSPLVPTR ETHFLRYCQQ  420
NVDEGTWAIV DFPIDSFNDN LQPSVPRYRR RPSGCIIQDM PNGYSRVTWV EHADVEEKPV  480
HHIFHHFVNS GMAFGATRWL AVLQRQCERV ASLMARNISD LGVIPSPEAR KNLMNLAQRM  540
IRTFSVNIST SSGQSWTALS DSSDDTVRIT TRKITEPGQP NGVILSAVST TWLPHPHYHV  600
FDLLRDERRR AQLDVLSNGN SLHEVAHIAN GSHPGNCISL LRINVASNSS QNVELMLQES  660
CTDQSGSHVV YTTIDVDAIQ LAMSGEDPSC IPLLPMGFAI VPVVPNNDCN IMTTTDDNPM  720
PPSGDGNGHN SGCLLTVGLQ VLASTIPTAK LNLSSVTAIN NHLCNTVHQI NAALSSICPD  780
NSSSMVGSST EPAAPPKQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.135050.0bud| flower
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4279440.0AM427944.2 Vitis vinifera contig VV78X076481.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277673.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_010663098.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_010663102.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A438GPS70.0A0A438GPS7_VITVI; Homeobox-leucine zipper protein ROC3
TrEMBLA5AJ700.0A5AJ70_VITVI; Uncharacterized protein
STRINGVIT_02s0012g02030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP94751113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7
Publications ? help Back to Top
  1. Velasco R, et al.
    A high quality draft consensus sequence of the genome of a heterozygous grapevine variety.
    PLoS ONE, 2007. 2(12): p. e1326
    [PMID:18094749]