PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01012643001
Common NameLOC100264009, VIT_10s0116g00680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 727aa    MW: 79665.4 Da    PI: 6.2904
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01012643001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2058113156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  GSVIVT01012643001  58 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 113
                        688999***********************************************998 PP

2START216.41e-672474671206
                        HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        ela +a++el+++a+a+ep+W   s    e++ +de+l++f+++ +      ++ea+r+++vv+m++  lve+l+d++ qW+  +     +a
  GSVIVT01012643001 247 ELAVAAMEELIRMAQAGEPLWIPTSdnstEILSEDEYLRTFPRGIGpkplgLKSEASRETAVVIMNHISLVEILMDVN-QWSSVFSgivsRA 337
                        57899*****************9999999**************999********************************.************* PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                        +tlev+s+g      galq+m+ae+q++splvp R+ +fvRy++ +++g+w++vdvS+d+ ++ p    + R +++pSg+li++++ng+skv
  GSVIVT01012643001 338 MTLEVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKHHPDGTWAVVDVSLDNLRSGP----ITRNRRRPSGCLIQELPNGYSKV 425
                        ****************************************************************9....6********************** PP

                        EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        +wvehv++++r +h+++r+lv+sgla+gak+wvatl+rqce+
  GSVIVT01012643001 426 IWVEHVEVDDRAVHNIYRPLVNSGLAFGAKRWVATLDRQCER 467
                        ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-2239113IPR009057Homeodomain-like
SuperFamilySSF466891.04E-1943115IPR009057Homeodomain-like
PROSITE profilePS5007116.89255115IPR001356Homeobox domain
SMARTSM003891.0E-1956119IPR001356Homeobox domain
PfamPF000463.5E-1858113IPR001356Homeobox domain
CDDcd000863.50E-1958116No hitNo description
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
SuperFamilySSF559617.56E-38238469No hitNo description
PROSITE profilePS5084846.73238470IPR002913START domain
CDDcd088754.05E-128242466No hitNo description
SMARTSM002341.4E-70247467IPR002913START domain
PfamPF018522.4E-56248467IPR002913START domain
Gene3DG3DSA:3.30.530.207.2E-7344467IPR023393START-like domain
SuperFamilySSF559618.24E-25487718No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MFQPNMFDSH HHLLDMPHKT PESEMGKIRD EEFESKSGTE NMDAPSGDDQ DPNQRPKKKR  60
YHRHTQHQIQ EMEAFFKECP HPDDKQRKEL SRELGLEPLQ VKFWFQNKRT QMKAQHERHE  120
NSNLRAENEK LRAENIRYKE ALSNATCPHC GGPASIGEMS FDEQHLRIEN ARLRDEIDRI  180
SGIAAKYVGK PMVSYPHLST HTSSRSLDLG VGNFGAQSGI VGDMYGGGDL LRSVSLPTEA  240
DKPMIVELAV AAMEELIRMA QAGEPLWIPT SDNSTEILSE DEYLRTFPRG IGPKPLGLKS  300
EASRETAVVI MNHISLVEIL MDVNQWSSVF SGIVSRAMTL EVLSTGVAGN YNGALQVMTA  360
EFQVPSPLVP TRENYFVRYC KHHPDGTWAV VDVSLDNLRS GPITRNRRRP SGCLIQELPN  420
GYSKVIWVEH VEVDDRAVHN IYRPLVNSGL AFGAKRWVAT LDRQCERLAS AMASNIPAGD  480
VGVITSPEGR KSMLKLAERM VMSFCAGVGA STTHTWTTLS GSGADDVRVM TRKSMDDPGR  540
PPGIVLSAAT SFWIPVPPKR VFDFLRAENS RSEWDILSNG GLVQEMAHIA NGRDPGNCVS  600
LLRVNSANSS QSNMLILQES CTDPTGSYVI YAPVDIVAMN VVLSGGDPDY VALLPSGFAI  660
LPDGAVLHGG GILDVGSGGS LLTVAFQILV DSAPTAKLSL GSVATVNSLI KCTVERIKAA  720
VSCENT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.194420.0bud| inflorescence
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4839510.0AM483951.2 Vitis vinifera contig VV78X162089.20, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266688.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A438JG680.0A0A438JG68_VITVI; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLE0CVM00.0E0CVM0_VITVI; Uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]