PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01011754001
Common NameLOC100257750, VIT_01s0011g04870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 226aa    MW: 25187.6 Da    PI: 8.6186
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01011754001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-1971125256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++k+q + Lee F++n++++ +++e LA++l+L  rqV vWFqNrRa+ k
  GSVIVT01011754001  71 RKKLRLSKDQSRLLEESFRQNHTLNPKQKEALAMQLKLRPRQVEVWFQNRRARSK 125
                        788899***********************************************98 PP

2HD-ZIP_I/II118.83e-3871159190
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                        +kk+rlsk+q++lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++eveeLr +
  GSVIVT01011754001  71 RKKLRLSKDQSRLLEESFRQNHTLNPKQKEALAMQLKLRPRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNRRLQREVEELR-A 159
                        69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-1953125IPR009057Homeodomain-like
SuperFamilySSF466894.6E-1960128IPR009057Homeodomain-like
PROSITE profilePS5007117.08667127IPR001356Homeobox domain
SMARTSM003891.3E-1769131IPR001356Homeobox domain
CDDcd000866.60E-1770128No hitNo description
PfamPF000468.7E-1771125IPR001356Homeobox domain
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
SMARTSM003404.0E-22127170IPR003106Leucine zipper, homeobox-associated
PfamPF021837.2E-10127161IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MDVIPMRSSS LELTISVPGF TSSPSLPSSA GEGVCGVRDL DINQVPLGAE EEWTTGSMED  60
EEESGNGGPP RKKLRLSKDQ SRLLEESFRQ NHTLNPKQKE ALAMQLKLRP RQVEVWFQNR  120
RARSKLKQTE MECEYLKRWF GSLTEQNRRL QREVEELRAM KVAPPTVISP HSCEPLPAST  180
LTMCPRCERV TTTSLGKDPT NRTTSPTLSS KLPTALHSRH SSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARSKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4276311e-167AM427631.2 Vitis vinifera contig VV78X110597.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657445.11e-164PREDICTED: homeobox-leucine zipper protein HOX3 isoform X1
SwissprotQ0JKX12e-87HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH382e-87HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLD7T8T61e-163D7T8T6_VITVI; Uncharacterized protein
STRINGVIT_01s0011g04870.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.16e-80homeobox-leucine zipper protein 17