PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01011710001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GRAS
Protein Properties Length: 409aa    MW: 44824.7 Da    PI: 4.8275
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01011710001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS469e-15162216155
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                        lv++L++cAeav++++l+la+al++++  la +++ +m+++a+yf+e+La+r++r
  GSVIVT01011710001 162 LVHTLMACAEAVQQENLKLAEALVKQIGFLAVSQAGAMRKVATYFAEGLARRIYR 216
                        689**************************************************98 PP

2GRAS191.17.2e-59224377116273
               GRAS 116 DfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlv 207
                        D +++qG+QWpaL+qaLa Rp+gpps+R+Tg+g+p++++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+ ++L+++ gE++aVn+v
  GSVIVT01011710001 224 DSSMKQGMQWPALMQALALRPGGPPSFRLTGIGPPSTDNTDHLHEVGWKLAQLAETIHVEFEYRGFVANSLADLDASMLELRDGESVAVNSV 315
                        7899**************************************************************************************** PP

               GRAS 208 lqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                        ++lh+ll++++ +e     vL++vk+++P++v++veqea+hn++ Fl+rf+e+l+yys+lfdsle 
  GSVIVT01011710001 316 FELHSLLARPGGIER----VLSAVKDMKPDIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG 377
                        *******99999999....*********************************************74 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098527.20817408IPR005202Transcription factor GRAS
PfamPF120411.5E-3344111IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.4E-3244117No hitNo description
PfamPF035143.1E-12162216IPR005202Transcription factor GRAS
PfamPF035142.5E-56224377IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGERDIKKEN VREYHHPHHP TCSTSPTGKG KMWDADPQQD AGMDELLAVL GYNVKASDMA  60
EVAQKLEQLE EVIVNAQEDG LSHLASETVH YNPSDLSNWL GSMLSDTQPK QEPSIFDSPS  120
LDYDLKAIPA NSVSSVIGGW GVPTESARPV VLVDSQETGI RLVHTLMACA EAVQQENLKL  180
AEALVKQIGF LAVSQAGAMR KVATYFAEGL ARRIYRLYPD KPLDSSMKQG MQWPALMQAL  240
ALRPGGPPSF RLTGIGPPST DNTDHLHEVG WKLAQLAETI HVEFEYRGFV ANSLADLDAS  300
MLELRDGESV AVNSVFELHS LLARPGGIER VLSAVKDMKP DIVTIVEQEA NHNGPVFLDR  360
FTESLHYYST LFDSLEGCGV SPFGNKRIGP FFGSNSMMKS LFQLNLDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2zsi_B3e-28261337107DELLA protein GAI
2zsh_B3e-28261337107DELLA protein GAI
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.1340.0inflorescence
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8343110.0HQ834311.1 Vitis vinifera GAI1 mRNA, complete cds.
GenBankHM2234310.0HM223431.1 Parthenocissus henryana voucher Nie & Meng 405 (KUN) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankEF1412950.0EF141295.1 Vitis sp. Nie 415 GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447660.0KT344766.1 Vitis tiliifolia voucher Wen 8713 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447650.0KT344765.1 Vitis sp. Zhang 347 GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447570.0KT344757.1 Vitis pseudoreticulata voucher Wen 11619 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447540.0KT344754.1 Vitis piasezkii voucher Wen 9036 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447520.0KT344752.1 Vitis mengziensis voucher Nie & Meng 415 (KUN, US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447500.0KT344750.1 Vitis menghaiensis voucher Nie & Meng 405 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447420.0KT344742.1 Vitis heyneana voucher Wen 10647 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447410.0KT344741.1 Vitis heyneana voucher Wen 10815 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447370.0KT344737.1 Vitis davidii voucher Wen 9060 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447360.0KT344736.1 Vitis cinerea var. helleri voucher Wen 9709 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447310.0KT344731.1 Vitis bellula voucher Wen 11271 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447290.0KT344729.1 Vitis amurensis voucher Wen 8583 (US) GAI-like protein 1 (GAI1) gene, partial cds.
GenBankKT3447260.0KT344726.1 Vitis sp. Wen 10025 GAI-like protein 1 (GAI1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284648.10.0PREDICTED: DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLF6HFG40.0F6HFG4_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g05260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-161GRAS family protein