PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01011377001
Common NameVIT_14s0108g00390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 284aa    MW: 32096 Da    PI: 6.6771
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01011377001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.42.2e-1773126356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  GSVIVT01011377001  73 KKRRLNLEQVKTLEKNFELGNKLEPERKMQLARTLGLQPRQIAIWFQNRRARWK 126
                        4557899**********************************************9 PP

2HD-ZIP_I/II127.65.5e-4172162191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+++a+k++n++L++++++L++el
  GSVIVT01011377001  72 EKKRRLNLEQVKTLEKNFELGNKLEPERKMQLARTLGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQFEAVKADNDALQAQNKKLHAEL 162
                        69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-1850129IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1960130IPR009057Homeodomain-like
PROSITE profilePS5007117.26568128IPR001356Homeobox domain
SMARTSM003898.4E-1771132IPR001356Homeobox domain
CDDcd000861.97E-1573129No hitNo description
PfamPF000469.6E-1573126IPR001356Homeobox domain
PRINTSPR000311.1E-599108IPR000047Helix-turn-helix motif
PROSITE patternPS000270103126IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5108124IPR000047Helix-turn-helix motif
PfamPF021831.5E-14128168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MAFLPTDFLF QTHLEDHPPY TSHTGLPSCT PQDFHGVIPV LMKRSMSFSG VDGCEEVHGD  60
DDFSDDGSQA GEKKRRLNLE QVKTLEKNFE LGNKLEPERK MQLARTLGLQ PRQIAIWFQN  120
RRARWKTKQL EKDYDLLKRQ FEAVKADNDA LQAQNKKLHA ELLALKSREP KGVGPINLNK  180
ETDQISWSNG SEHSSGINLD ISRTTLINSP VSSQLSSKQF FPSSLRPASI TQLLQGSPRS  240
DIHCQKIDQI VQDESFCNIF SGISDQSGLW AWPEQDHFHQ NQA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120128RRARWKTKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in leaves and flowers. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3846330.0FQ384633.1 Vitis vinifera clone SS0AAG17YM12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661046.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC037e-84ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLD7SX880.0D7SX88_VITVI; Uncharacterized protein
STRINGVIT_14s0108g00390.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-86HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]