PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01010625001
Common NameLOC100243436, VIT_16s0100g00440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 154aa    MW: 17235.6 Da    PI: 8.9766
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01010625001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.79.2e-3941041101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+C++dC+++ yfp+++p++fa vh+++Gasn+ k+l+++p++ r +a++s++yeA++r+ dPvyG v++i+ l+q+++++++
  GSVIVT01010625001   4 RCAACKYLRRRCPPDCIFSSYFPSNDPQRFASVHRIYGASNIGKMLQQIPPHLRAEATESMYYEAQCRVADPVYGIVKTISLLNQEIHHAQS 95 
                        6******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        +la++++++
  GSVIVT01010625001  96 QLAKVQAQI 104
                        *****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.3953104IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-394101IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MNSRCAACKY LRRRCPPDCI FSSYFPSNDP QRFASVHRIY GASNIGKMLQ QIPPHLRAEA  60
TESMYYEAQC RVADPVYGIV KTISLLNQEI HHAQSQLAKV QAQIAFYNAQ VHGNNKIQNV  120
ELPSSNFNNS LANQGDAFPH PTLPLSIRPS WSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-37510712114LOB family transfactor Ramosa2.1
5ly0_B7e-37510712114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4824891e-164AM482489.1 Vitis vinifera contig VV78X039920.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274838.11e-112PREDICTED: LOB domain-containing protein 24
SwissprotP594686e-48LBD24_ARATH; LOB domain-containing protein 24
TrEMBLD7TMW81e-111D7TMW8_VITVI; Uncharacterized protein
STRINGVIT_16s0100g00440.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-50LOB domain-containing protein 24