PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01010600001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 886aa    MW: 99434.5 Da    PI: 6.9069
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01010600001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-193993357
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
           Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                       k +++t+eq++eLe++F++ ++p++++r +L++kl+L+ rqVk+WFqNrR+++k+
  GSVIVT01010600001 39 KYHRHTQEQINELETCFKEWPHPDEKQRLDLSRKLNLEPRQVKFWFQNRRTQMKN 93
                       56789***********************************************995 PP

2START165.73.2e-522004031206
                        HHHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
              START   1 elaeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
                        ela +a++el+++a+a++p W++s   + g+e+l +          a+r++g+v  ++  lve+l+d + +W ++++    ka+t++v+ssg
  GSVIVT01010600001 200 ELAVTAMDELLRLAQADSPIWMTSL--DGGKETL-N---------PASRETGMVMINSLALVETLMDGS-RWAQMFPcviaKASTTDVLSSG 278
                        57899********************..4444444.3.........379*********************.********************** PP

                        ......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
              START  89 ......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                              galqlm aelq+lsplvp R + f+R+++q+g+g w++vdvS+d   +  +  s+v +++l+Sg++++++sng+++vtw+eh +++
  GSVIVT01010600001 279 igrtrhGALQLMHAELQVLSPLVPvRQVKFLRFCKQHGEGLWAVVDVSIDTALDGASINSFVNCRRLLSGCVVQDLSNGYTRVTWIEHSEYD 370
                        *******************************************************999********************************** PP

                        SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                        ++ +h+l+rsl++sgl +ga +w+atlqrqce+
  GSVIVT01010600001 371 ESAVHYLYRSLLSSGLGFGALRWLATLQRQCES 403
                        *******************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.14E-192594IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-1934100IPR009057Homeodomain-like
PROSITE profilePS5007116.5523494IPR001356Homeobox domain
SMARTSM003892.5E-153698IPR001356Homeobox domain
PfamPF000466.6E-173992IPR001356Homeobox domain
CDDcd000868.63E-173994No hitNo description
PROSITE patternPS0002706992IPR017970Homeobox, conserved site
PROSITE profilePS5084840.751191406IPR002913START domain
CDDcd088751.39E-101196402No hitNo description
SuperFamilySSF559611.06E-30198403No hitNo description
SMARTSM002344.1E-36200403IPR002913START domain
PfamPF018521.7E-45201403IPR002913START domain
SuperFamilySSF559617.55E-16451646No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 886 aa     Download sequence    Send to blast
MGRINEDGYE SMSGSGNLDG GLEDEQETLV LERPAKKLKY HRHTQEQINE LETCFKEWPH  60
PDEKQRLDLS RKLNLEPRQV KFWFQNRRTQ MKNQLERHEN VMLRQENDKL RVENVAIKDA  120
VRNPICNHCG GVAMLGNITI EENQLRVENA QLRDELSRIC GLAEKFLGRP VTPLASPIAL  180
PRPSSNLELE VAGNGSVFVE LAVTAMDELL RLAQADSPIW MTSLDGGKET LNPASRETGM  240
VMINSLALVE TLMDGSRWAQ MFPCVIAKAS TTDVLSSGIG RTRHGALQLM HAELQVLSPL  300
VPVRQVKFLR FCKQHGEGLW AVVDVSIDTA LDGASINSFV NCRRLLSGCV VQDLSNGYTR  360
VTWIEHSEYD ESAVHYLYRS LLSSGLGFGA LRWLATLQRQ CESIAILLSS TVPCEDHPVL  420
TQAGRRSLLQ LTNRMRDNFC AGVCASTVRM WNKLHVASLG EDVKVMTRKS MNIPGEPPGV  480
ILSAATSVWM PIMHQQLFNF LRDERQRSKW DILSNGGPMQ EMIHIPKGQT SSNCVSLLRP  540
NARNQNDNTM LILQETWADA SGSLIVYAPL DVASMRAVMT GGDSSFVALL PSGFAIVPDG  600
SSNKGSGSLL TVAFQILVNS LPMAKLNVES VETVNSLLSC TINKIKSAII IAKTLNPGNS  660
FHKMPIFYSS PINPLKSVSF LIRSLTWTRP MSQSTSIPKK LQRVRDHGYD NYMEVEKKLR  720
KILKFQDLFL CQPHQTLPLV LLSPRKANVD RELVNYRRDR EDDEMVRIQS DYVESRFEGF  780
VDENNFRQDG ERGRDSDLNL DSDAGSDFSD EDNKCEETTD FQGLFGWWEF FLFGCFSSTS  840
FQENNAVSGL KRSKISTSPD SKLSSLCFIY KLNINLYFIN HNHSK*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4343720.0AM434372.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X118216.6, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634081.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_019081402.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_019081403.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLF6HP550.0F6HP55_VITVI; Uncharacterized protein
STRINGVIT_16s0100g00670.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]