PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01009274001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 299aa    MW: 33797.4 Da    PI: 8.9526
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01009274001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.3e-19126180256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tkeq  +Le+ F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  GSVIVT01009274001 126 RKKLRLTKEQAVILEDSFKQHSTLNPRQKQVLAKQLNLRPRQVEVWFQNRRARTK 180
                        78889************************************************98 PP

2HD-ZIP_I/II1192.5e-38126215191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rl+keq+ +LE+sF+++++L+p++K+ la++L+l+prqv+vWFqnrRARtk+kq+E+d+e L++++++l++en+rL+ke +eL+ +l
  GSVIVT01009274001 126 RKKLRLTKEQAVILEDSFKQHSTLNPRQKQVLAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLRKRCETLTDENQRLQKELQELK-AL 215
                        69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-17113176IPR009057Homeodomain-like
PROSITE profilePS5007117.248122182IPR001356Homeobox domain
SMARTSM003891.7E-15124186IPR001356Homeobox domain
SuperFamilySSF466891.03E-18124191IPR009057Homeodomain-like
PfamPF000462.6E-16126180IPR001356Homeobox domain
CDDcd000869.09E-15126183No hitNo description
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
PfamPF021836.3E-9182216IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.9E-21182225IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGFEDVCCTG LGLGLGRQDR PQSRLQSDHQ EKKKKLCLKY DNSFPCLTLG PSEDTYQLAA  60
KINDAGKGYG ESTDLHRQAS SLSAVSSFSN SSIKKERDLC GEVEVEVEIE RVSSRASDED  120
EEGNSRKKLR LTKEQAVILE DSFKQHSTLN PRQKQVLAKQ LNLRPRQVEV WFQNRRARTK  180
LKQTEVDCEL LRKRCETLTD ENQRLQKELQ ELKALKLATP LYMQLPAATL TMCPSCERIG  240
SGGDASSKTS FTIGAKPRFS ITDFYSSGNL SFHLFVWIRG KSMRNINLDE LVVRRPHH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130SRKKLRL
2174182RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.267040.0bud| pedicel
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4712560.0AM471256.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X050940.4, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283547.10.0PREDICTED: homeobox-leucine zipper protein HAT22
SwissprotP466041e-77HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLF6H1620.0F6H162_VITVI; Uncharacterized protein
STRINGVIT_18s0001g08410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-67HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]