PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01009273001
Common NameLOC100255834, VIT_18s0001g08380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family TALE
Protein Properties Length: 342aa    MW: 39394 Da    PI: 5.9846
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01009273001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-092683032055
                        HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  GSVIVT01009273001 268 YKWPYPSETEKVALAETTGLDQKQINNWFINQRKRH 303
                        5679*****************************885 PP

2ELK383.5e-13223244122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELK++LlrKYsgyL+sLkqE+s
  GSVIVT01009273001 223 ELKNHLLRKYSGYLSSLKQELS 244
                        9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.2E-2379123IPR005540KNOX1
PfamPF037901.6E-2380122IPR005540KNOX1
SMARTSM012567.3E-27130181IPR005541KNOX2
PfamPF037911.3E-23135179IPR005541KNOX2
SMARTSM011883.5E-7223244IPR005539ELK domain
PfamPF037892.3E-10223244IPR005539ELK domain
PROSITE profilePS5121311.296223243IPR005539ELK domain
PROSITE profilePS5007112.876243306IPR001356Homeobox domain
SuperFamilySSF466891.41E-19244318IPR009057Homeodomain-like
SMARTSM003891.5E-12245310IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.0E-27248309IPR009057Homeodomain-like
CDDcd000862.11E-11255307No hitNo description
PfamPF059201.1E-16263302IPR008422Homeobox KN domain
PROSITE patternPS000270281304IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEDYNQLGEN TTSRASFLYT SSVLAPNSSC FQSEAHPVVK TEASTSQHAQ KFHYPIIRGH  60
QTVDHQQQQQ GNESFSEVEA IKAKIIAHPQ YSNLLEAYMD CQKVGAPPEV VERLAAVRQE  120
FESRQRSSVT CRDASKDPEL DQFMEAYYDM LVKYREELTR PLQEATDFMR RIESQLNMLS  180
NGPVRIFTSD EKCEGVGSSE EDQDNSGGET ELPEIDPRAE DRELKNHLLR KYSGYLSSLK  240
QELSKKKKKG KLPKDARQKL LNWWELHYKW PYPSETEKVA LAETTGLDQK QINNWFINQR  300
KRHWKPSEDM QFMVMDGLHP QNAALYMESH YMGDGAYRLG P*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.166580.0bud| inflorescence
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285521.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-177KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLF6H1590.0F6H159_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g08380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-144KNOTTED-like from Arabidopsis thaliana