PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01009083001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 313aa    MW: 35430.9 Da    PI: 5.707
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01009083001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1858110456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        + +++ +q+++Le+ Fe ++++  e++ ++A++lgL+ rqV +WFqNrRa++k
  GSVIVT01009083001  58 KKRLSFDQVKALERSFEIENKLEPERKVKIAEELGLKPRQVAIWFQNRRARWK 110
                        4456779*********************************************9 PP

2HD-ZIP_I/II128.23.4e-4156148193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekk+rls +qvk+LE+sFe e+kLeperKv++a+eLgl+prqva+WFqnrRAR+ktkqlE+dy  Lk++ydalk + e+Le+e+e+L +el+
  GSVIVT01009083001  56 EKKKRLSFDQVKALERSFEIENKLEPERKVKIAEELGLKPRQVAIWFQNRRARWKTKQLERDYGILKANYDALKLDYESLEQEKEALVAELR 147
                        69**************************************************************************************9998 PP

        HD-ZIP_I/II  93 e 93 
                        e
  GSVIVT01009083001 148 E 148
                        6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-1846114IPR009057Homeodomain-like
PROSITE profilePS5007116.64952112IPR001356Homeobox domain
SMARTSM003891.7E-1555116IPR001356Homeobox domain
CDDcd000861.68E-1657113No hitNo description
PfamPF000461.5E-1558110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.5E-1959118IPR009057Homeodomain-like
PRINTSPR000312.5E-58392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000312.5E-592108IPR000047Helix-turn-helix motif
PfamPF021834.1E-18112154IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MKRFSSSVSL APLVSMCSPK EGKNSKNYPV YDSEFQAMLD SFDEEDCAEE TGLITEKKKR  60
LSFDQVKALE RSFEIENKLE PERKVKIAEE LGLKPRQVAI WFQNRRARWK TKQLERDYGI  120
LKANYDALKL DYESLEQEKE ALVAELRELK AKLQGGNMEL NQSVKEEALV SESENNVSEQ  180
GKNNGNISGI HGLGDFKDGS SDTSSSSLRL NCASLSSPSP MNWFPSKAFQ HQFGRMEEQS  240
FFSAEEPCNF FWGDQAPSLH WYFPDHGHNL FGLFRRLNAS LYPLQGNVGL ISLIHSHPII  300
IILTIKPSPL TE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.141230.0bud| flower| fruit| inflorescence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4723790.0AM472379.2 Vitis vinifera contig VV79X008371.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285743.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6
TrEMBLF6H0X80.0F6H0X8_VITVI; Uncharacterized protein
STRINGVIT_18s0001g06430.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-56homeobox protein 16