PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008570001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family NF-YC
Protein Properties Length: 216aa    MW: 23729.1 Da    PI: 4.7148
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008570001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC40.84.8e-13135435
              NF-YC  4 sfwekq...iekatdfknhelPlarikkilkaded 35
                       +fw++q   ie+++dfknh+lPlarikki+kaded
  GSVIVT01008570001  1 MFWSYQrqeIEQVNDFKNHQLPLARIKKIMKADED 35
                       5898887789************************9 PP

2NF-YC391.7e-12356770102
              NF-YC  70 krrtlkksdiaaavtrtdifdflvdivprdelk 102
                        +rrtl+k+diaaa+trtdifdflvdivprde+k
  GSVIVT01008570001  35 DRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIK 67 
                        69****************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.56E-12757IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.7E-81235IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.1E-83663IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MFWSYQRQEI EQVNDFKNHQ LPLARIKKIM KADEDRRTLQ KNDIAAAITR TDIFDFLVDI  60
VPRDEIKDEG GLGMVGSTAS GVPYYYPPMG QPAPGVMMGR PAVPGVDPGV YVQPPSQAWQ  120
SVWQTAEDGS YGSGGSSGQG NLDGQGVGFL PPPPIIVYLF GEEGFDLRPG DEKGVEVRQP  180
VMLFSSLCCT RIASTCKNID ILSKRPLWML WCFPA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13541RRTLQKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.126310.0bud| flower| fruit| inflorescence| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3958720.0FQ395872.1 Vitis vinifera clone SS0AFA13YG24.
GenBankFQ3921380.0FQ392138.1 Vitis vinifera clone SS0AFA7YF12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284041.11e-85PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1
RefseqXP_010663766.11e-85PREDICTED: nuclear transcription factor Y subunit C-1 isoform X2
SwissprotQ9SMP04e-64NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA5AFH02e-85A5AFH0_VITVI; Putative uncharacterized protein
TrEMBLF6GSW83e-85F6GSW8_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g01130.t019e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31517117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.11e-63nuclear factor Y, subunit C1