PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008395001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB
Protein Properties Length: 1319aa    MW: 147897 Da    PI: 8.9427
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008395001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.7e-14456501248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          WT +Ed +l  av+ +G g+W +Ia+ ++ gRt+ qc +rw k l
  GSVIVT01008395001 456 REWTVDEDAQLRTAVEDFGEGNWQLIASVLQ-GRTGTQCSNRWKKTL 501
                        68*****************************.***********9975 PP

2Myb_DNA-binding49.21.2e-15509552246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        grWT++Ed++l+ av ++G++tW++Ia+ +  gRt  qc++rw +
  GSVIVT01008395001 509 GRWTADEDKRLKVAVMLFGPKTWTKIAEFVL-GRTQVQCRERWVN 552
                        8*****************************9.***********87 PP

3Myb_DNA-binding41.14.2e-13561604247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        g WT eEd +l+ a+ ++G   W+++a++++  Rt+ qc+ rw  +
  GSVIVT01008395001 561 GQWTGEEDAKLKAAIMEHGYC-WSKVAACIP-PRTDSQCRRRWKVL 604
                        68*****************99.*********.9**********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.021301398IPR001005SANT/Myb domain
PROSITE profilePS500905.448302394IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.6E-8304320IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-8369409IPR009057Homeodomain-like
SuperFamilySSF466898.59E-15378450IPR009057Homeodomain-like
PROSITE profilePS500908.293397449IPR017877Myb-like domain
SMARTSM007170.061401451IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-9410458IPR009057Homeodomain-like
SuperFamilySSF466892.66E-19434504IPR009057Homeodomain-like
PROSITE profilePS5129421.285450505IPR017930Myb domain
SMARTSM007172.5E-15454503IPR001005SANT/Myb domain
PfamPF002498.2E-13456500IPR001005SANT/Myb domain
CDDcd001671.09E-12457501No hitNo description
Gene3DG3DSA:1.10.10.602.5E-16459504IPR009057Homeodomain-like
SuperFamilySSF466893.26E-25505601IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-17505554IPR009057Homeodomain-like
PROSITE profilePS5129412.402506554IPR017930Myb domain
SMARTSM007171.4E-13507556IPR001005SANT/Myb domain
PfamPF002493.8E-14509552IPR001005SANT/Myb domain
CDDcd001672.85E-11510554No hitNo description
PROSITE profilePS5129420.616555609IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-16555603IPR009057Homeodomain-like
SMARTSM007178.5E-11559607IPR001005SANT/Myb domain
PfamPF002491.2E-11561603IPR001005SANT/Myb domain
CDDcd001671.70E-11563605No hitNo description
SuperFamilySSF509781.26E-4610591314IPR017986WD40-repeat-containing domain
SMARTSM003202.8E-410591099IPR001680WD40 repeat
CDDcd002002.39E-5510621313No hitNo description
Gene3DG3DSA:2.130.10.101.4E-4610621314IPR015943WD40/YVTN repeat-like-containing domain
PfamPF004000.2110641098IPR001680WD40 repeat
PROSITE profilePS5029432.21910661318IPR017986WD40-repeat-containing domain
PROSITE profilePS5008210.54210661108IPR001680WD40 repeat
SMARTSM003201.7E-611071146IPR001680WD40 repeat
PfamPF004002.0E-611101146IPR001680WD40 repeat
PROSITE profilePS5008214.88611141155IPR001680WD40 repeat
PROSITE patternPS00678011331147IPR019775WD40 repeat, conserved site
PRINTSPR003201.8E-511331147IPR020472G-protein beta WD-40 repeat
SMARTSM003207.9E-911491188IPR001680WD40 repeat
PfamPF004001.4E-611541188IPR001680WD40 repeat
PROSITE profilePS5008214.75311561188IPR001680WD40 repeat
PRINTSPR003201.8E-511751189IPR020472G-protein beta WD-40 repeat
PROSITE patternPS00678011751189IPR019775WD40 repeat, conserved site
SMARTSM003200.007211901252IPR001680WD40 repeat
PfamPF004000.0311951231IPR001680WD40 repeat
SMARTSM003200.002412791314IPR001680WD40 repeat
PROSITE profilePS5008210.40812901318IPR001680WD40 repeat
PfamPF004000.005312901313IPR001680WD40 repeat
PRINTSPR003201.8E-513011315IPR020472G-protein beta WD-40 repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1319 aa     Download sequence    Send to blast
MASQSGESDD DNDSALDEDL EALRRACILT GSNLNDRATS SGVAATSGAA SDADSEGIDD  60
LELVRNIQKR FSIPSEDVPA PLSLKPLSFL PPAVSDEDED DFEILRAIQK RFSAYHEDTP  120
KSGVDNNLQK KEKVLDSGKQ QVDSEDASNS TLNLESFGSK VPENHSSRLG ASNFPPLLSK  180
QTSFPKLGHM FVDALKKNRS CQRFLRSKLI ELEARLEENK KLKERVKILK DFQVSCRRRM  240
GRALSQKKDA RVQLISLPKL KASKNSKVND KKVSAIYYGP AENAHVANYR MALTEFPLSF  300
TRAKWSKLEM QNLVKGIKQQ FQEMLLQKSV DMFSGSERSF EDPNDFDNIM GSITDLEIPP  360
ENIRLFLPKV NWEQLASMYV AGRSAAECEA RWLNCEDPLI NHDPWNVTED KKLLFILQQR  420
GLNSWIDIAV SLRTNRTPFQ CLARYQRSLN ACILKREWTV DEDAQLRTAV EDFGEGNWQL  480
IASVLQGRTG TQCSNRWKKT LHPARHRVGR WTADEDKRLK VAVMLFGPKT WTKIAEFVLG  540
RTQVQCRERW VNSLDPSLNW GQWTGEEDAK LKAAIMEHGY CWSKVAACIP PRTDSQCRRR  600
WKVLFPHEVP LLQAARKIQK VALISNFVDR ESERPALGPK DFLPVPEMDS VSEPQKDSQK  660
RKRKSKVQPE TEGENNAASR NVPKKKRSQK PRNGAETSSK EVPGNSNANE VDKVGGDDAN  720
SKKRKRVRKP QSRKAKCSEP IQDRPSSDLD SAMLVITNGE EVGEFAMQGC PSSDIGSAML  780
MITNGEEVGE FGGHDITDKG DSLVSHSKRV STVSPESLDP RIIDVDGIET IGANDTTSRR  840
KKSTPKRHPK MNKCAEQSGE HQDSTLNVNG AMSKKMRRAP KRPLKRKMGA DQSEEHQASS  900
SHVDSTFDGN NATSNMKKRT PKLHPRRRIY IEQSEEHQAS SACLESITSG QAVGTSGGGI  960
LIEERAPKPQ MQICVEATEN RPDTSLHGDS RATVCQQDRP KRVFPQCHII VSHSHQNPNR  1020
HNPYKYLLSY RISLPSSRLS HENPNPRERE RESSKMAETL VLRGTMRAHT DMVTAIATPI  1080
DNSDMIVTSS RDKSIILWHL TKDDKTYGVP RRRLTGHSHF VQDVVLSSDG QFALSGSWDG  1140
ELRLWDLAAG TSARRFVGHT KDVLSVAFSV DNRQIVSASR DRTIKLWNTL GECKYTIQDA  1200
DAHSDWVSCV RFSPNNLQPT IVSASWDRTV KDGVILLYWL CAATEQSIKI WDLESKSIVE  1260
DLKVDLKTEA EKSEDTTTTA KKKGKIIYCT SLSWSADGST LFSGYTDGVV RVWGIGRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3dm0_A1e-13610601318372694Maltose-binding periplasmic protein fused wit
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1880887KRPLKRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4723300.0AM472330.2 Vitis vinifera contig VV79X004925.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278062.20.0PREDICTED: snRNA-activating protein complex subunit 4 isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1