PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008234001
Common NameVIT_17s0000g04180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family TCP
Protein Properties Length: 367aa    MW: 41570.8 Da    PI: 8.9711
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008234001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP133.12.5e-411372513133
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksa 94 
                         k+drhski T++g+RdRR+Rls+e+a++fFdLqd+LGfdk+skt+eWLl +ak aikel + +s+s+ +                +++ ++
  GSVIVT01008234001 137 SKRDRHSKINTARGPRDRRMRLSLEIARKFFDLQDMLGFDKASKTVEWLLIKAKSAIKELSRGGSISKGKR---------------SKCLTK 213
                        69*************************************************************99998111...............222233 PP

                TCP  95 akskksqksaasalnlakesrakarararertrekmrik 133
                         ++k +q+++++++ la+esr+karararertrekm  +
  GSVIVT01008234001 214 -ERKTRQSRKNAFQPLARESREKARARARERTREKMWSR 251
                        .44555555566799*********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.5E-35137203IPR005333Transcription factor, TCP
PROSITE profilePS5136936.022138196IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137012.052230247IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MEIGIHANSL ACARLRCPGA IFQPQMFLSN SNGNNPISYP DQTILHAPFI TDVSHNSQQE  60
DPPSSFFYFP SPFIHYEDDA FLQHNDLIPQ LQALMPGDTL ADTMVNMVNS NKNSNELIGD  120
RKQSNSVTEP IMQKRSSKRD RHSKINTARG PRDRRMRLSL EIARKFFDLQ DMLGFDKASK  180
TVEWLLIKAK SAIKELSRGG SISKGKRSKC LTKERKTRQS RKNAFQPLAR ESREKARARA  240
RERTREKMWS RRLDESKVCA EANSHDLNHL GSISSFETGE ESGSQSHNLI PSLELLPEVE  300
EPSSNEQHHS GITEAMLDNS LVIMSKQWSP SSIFNYLNFG ISQEPQFPGF QFHGKPWEAH  360
SNQNLC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4342430.0AM434243.2 Vitis vinifera contig VV78X064736.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275255.20.0PREDICTED: transcription factor DICHOTOMA
RefseqXP_010663543.10.0PREDICTED: transcription factor DICHOTOMA
RefseqXP_010663544.10.0PREDICTED: transcription factor DICHOTOMA
RefseqXP_019081914.10.0PREDICTED: transcription factor DICHOTOMA
TrEMBLD7SIV00.0D7SIV0_VITVI; Uncharacterized protein
STRINGVIT_17s0000g04180.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-27TCP domain protein 12