PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008156001
Common NameVIT_17s0000g04850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 256aa    MW: 27908.2 Da    PI: 9.1287
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008156001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.7e-392585262
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +++alkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  GSVIVT01008156001 25 QNQALKCPRCESLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSK 85
                       57899****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-242578IPR003851Zinc finger, Dof-type
PfamPF027013.1E-332783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4882983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MQDIHSMGAG GGRIFGGDRR LRPHQNQALK CPRCESLNTK FCYYNNYNLS QPRHFCKSCR  60
RYWTKGGVLR NVPVGGGCRK TKRSKAKSSS DAPRERKSNS HSSSESSSLT ATTTAAATTA  120
TTEAVSAPSS NAASTLMTGS NDPAALGFNI SDISPFKYQE QEITAGFLDQ TVQVELSALQ  180
NRSNHGGFPS LDWQTSGDQG IFDLPGNVDQ GYWTQSQCVL FSPLLGFSFF LSNVFPIKLI  240
KYRKNIECFV CLDAS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.151780.0bud| fruit| inflorescence| root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4365490.0AM436549.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X263908.20, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267092.11e-117PREDICTED: dof zinc finger protein DOF5.4
SwissprotQ8LDR09e-45DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLF6GTE91e-147F6GTE9_VITVI; Uncharacterized protein
STRINGVIT_17s0000g04850.t011e-148(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.14e-32OBF binding protein 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Xu P,Chen H,Ying L,Cai W
    AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana.
    Sci Rep, 2016. 6: p. 27705
    [PMID:27297966]
  3. Ramirez-Parra E, et al.
    The transcription factor OBP4 controls root growth and promotes callus formation.
    New Phytol., 2017. 213(4): p. 1787-1801
    [PMID:27859363]
  4. Rymen B, et al.
    ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator.
    Plant Physiol., 2017. 173(3): p. 1750-1762
    [PMID:28167701]