PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008080001
Common NameLOC100262064, VIT_17s0000g05490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 302aa    MW: 33068.9 Da    PI: 5.4662
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008080001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.93.4e-38101091100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkC+++C+lapyfp +qpk fa +h+lFG+sn+lk+lk+l+++++ +am+s++y+A +r r Pv+G++g+i +l+ q++q++ 
  GSVIVT01008080001  10 ACAACKYQRRKCSSECPLAPYFPPDQPKMFADAHRLFGVSNILKILKQLDPTQKLTAMQSIIYQATIRERYPVSGCLGLICQLHYQIRQTED 101
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el+++ ++
  GSVIVT01008080001 102 ELHVVLSQ 109
                        **987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9539110IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-3710106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009029anatomystamen
PO:0025281anatomypollen
PO:0007016developmental stagewhole plant flowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRK CSSECPLAPY FPPDQPKMFA DAHRLFGVSN ILKILKQLDP  60
TQKLTAMQSI IYQATIRERY PVSGCLGLIC QLHYQIRQTE DELHVVLSQL EICRQHHHQQ  120
IQMASAPSDS SSSPLELGCS ALSLHHNPPP PPPEYNAVSV AGGGDGGLPV GVGTHHPYSP  180
TTNAPFNFDF LDPKDNSLNP VWPQNSFSIT NNNDVHNSLT IQPQPVATQP LPLQPQAAQD  240
YDEIHPFFDT FDDRQSYVDS KEAYESSSES SFKDATQSTD NVAENELKSA AACFSLISLG  300
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-2661107111LOB family transfactor Ramosa2.1
5ly0_B4e-2661107111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4321270.0AM432127.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X012423.11, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010663422.10.0PREDICTED: LOB domain-containing protein 27
TrEMBLA0A438I3510.0A0A438I351_VITVI; LOB domain-containing protein 27
TrEMBLD7SII00.0D7SII0_VITVI; Uncharacterized protein
STRINGVIT_17s0000g05490.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.17e-48LOB domain-containing protein 27