PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008065001
Common NameLOC100260419, VIT_17s0000g05630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 264aa    MW: 30398.8 Da    PI: 4.3671
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008065001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.5e-1971124356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t++q++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  GSVIVT01008065001  71 KKRRLTADQVQFLERNFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWK 124
                        56789************************************************9 PP

2HD-ZIP_I/II127.27.3e-4170160191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        ekkrrl+++qv++LE++Fe e+kLeperKv+la++Lglqprqva+WFqnrRAR+ktkqlEkd+ aL+++y++lk+e e+L ke++eL++e+
  GSVIVT01008065001  70 EKKRRLTADQVQFLERNFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDFGALQASYNSLKAEYENLLKEKDELKTEV 160
                        69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-2052128IPR009057Homeodomain-like
PROSITE profilePS5007117.44366126IPR001356Homeobox domain
SMARTSM003893.4E-1869130IPR001356Homeobox domain
CDDcd000868.73E-1771127No hitNo description
PfamPF000469.5E-1771124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-1972132IPR009057Homeodomain-like
PRINTSPR000316.6E-697106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000316.6E-6106122IPR000047Helix-turn-helix motif
PfamPF021831.1E-14126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MLQNQRVPCS SQPLDALFLS ASSPSFLGSR SMLSFEDVRA GKRPDNPFFC QFDHDENGDE  60
DLDEYFHQPE KKRRLTADQV QFLERNFEVE NKLEPERKVQ LAKDLGLQPR QVAIWFQNRR  120
ARWKTKQLEK DFGALQASYN SLKAEYENLL KEKDELKTEV ILLTDKLLVK EKERGNLEVS  180
NTDTLSQELP QVVVADSPGD SSYVFEADQS DVSQDEEDNF SKSLLPPSYI FPKLEDVDYP  240
DPPTNPCSFG FPVEDHAFWS WSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.46670.0bud| cell culture| fruit| inflorescence| leaf| pedicel
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3973870.0FQ397387.1 Vitis vinifera clone SS0AEB6YP12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271692.10.0PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022832e-41HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A438I3590.0A0A438I359_VITVI; Homeobox-leucine zipper protein HAT5
TrEMBLF6GTA70.0F6GTA7_VITVI; Uncharacterized protein
STRINGVIT_17s0000g05630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-43homeobox 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Arce AL,Chan RL
    A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype.
    Plant Physiol., 2017. 175(3): p. 1238-1253
    [PMID:28956754]