PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01007992001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 368aa    MW: 40471.1 Da    PI: 6.0169
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01007992001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-39117177262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  GSVIVT01007992001 117 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNSA 177
                        7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30110174IPR003851Zinc finger, Dof-type
PfamPF027012.2E-32119175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.882121175IPR003851Zinc finger, Dof-type
PROSITE patternPS013610123159IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MQEPKDPAFK LFGKTIPMLA DGDAPVSSGD VGDSGAAVAR EDGLEEETEK DALGGKPAET  60
KGEDGSEESR NSETVAESNE NPKTPSIAEE NVTLKTSKAE KGQSDSPDSQ EKTLKKPDKI  120
LPCPRCNSMD TKFCYYNNYN INQPRHFCKS CQRYWTAGGT MRNVPVGAGR RKNKNSASHY  180
RHITISEALQ TENGDDHSSA SSITVSNSSE EGSKYGLHEA KRNSHGVPSR IPCIPGIPWP  240
YPWNSAVPPP FCPPGFPMPF YPAAYWNCHV TAPWNIPWEG DILKPSIVED EETPKQRSSE  300
RCLWVPKTLR IDDPAEAAKS SIWTTLGIKN DKNEEGDWTM NRAYALSPHL APIIIPCSHR  360
TGIFCHL*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3803860.0FQ380386.1 Vitis vinifera clone SS0ACG65YM06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281994.11e-178PREDICTED: cyclic dof factor 3
SwissprotQ93ZL54e-72CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A438I1B60.0A0A438I1B6_VITVI; Cyclic dof factor 3
TrEMBLA5CAA80.0A5CAA8_VITVI; Uncharacterized protein
STRINGVIT_17s0000g06310.t011e-177(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-68cycling DOF factor 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]