PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01007843001
Common NameVIT_17s0000g07510, VITISV_040763
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 259aa    MW: 28741.9 Da    PI: 10.0743
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01007843001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-1481125347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  GSVIVT01007843001  81 PWTEEEHKLFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 125
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.93974130IPR017930Myb domain
SuperFamilySSF466892.17E-1776131IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-1777128IPR006447Myb domain, plants
SMARTSM007172.4E-1078128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-1180125IPR009057Homeodomain-like
CDDcd001671.21E-981126No hitNo description
PfamPF002498.1E-1281125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MSRCCSQCGH NGHNSRTWIM LFGVRVTVDS MRKSVSLNNL SQYEQPHESS NADATPAAGY  60
VSADDVAHHS SGNRERKRGV PWTEEEHKLF LVGLQKVGKG DWRGISRNFV KTRTPTQVAS  120
HAQKYFLRRN NLNRRRRRSS LFDITTESVT AVPMEEEQVL HHQENTSQSQ QSPKTFSETG  180
SGGQNDVNTR LVRPIPVLPI PPESTDLNLN LKSSVDPSPL SLKLSLSSNQ NHPNQPSRHS  240
AFQAMSSFNN GDSIISVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.74350.0bud| cell culture| flower| fruit| inflorescence| leaf
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT2162560.0KT216256.1 Vitis vinifera cultivar Cabernet Sauvignon MYB1R1 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283896.11e-156PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B04e-66MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA5C7A71e-155A5C7A7_VITVI; Uncharacterized protein
STRINGVIT_17s0000g07510.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.21e-60MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]