PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01007758001
Common NameLOC100265549, VIT_17s0000g08290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 319aa    MW: 35116.5 Da    PI: 7.2916
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01007758001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.92.9e-4051111262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+ 
  GSVIVT01007758001  51 HDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVA 111
                        7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2949109IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3352109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18955109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGLTFLPVCM DSSEWLQGTA HEENGMDSSS PSGDMLTCSR PLIERRLRPQ HDQALKCPRC  60
DSTHTKFCYY NNYSLSQPRY FCKTCRRYWT KGGTLRNIPV GGGCRKNKKV ASKKSNDHSI  120
NQNPGPSSHN PTDLHLSFPE VQFSHLSNLL GSHGGLGNHS FMESKYNGML ENARPIDFME  180
GKFEAIVGSS RNHDFMGNCE LGMGGLGDMS HGGLAPNFHG LCSPFGVTLD GNGGNFMDTC  240
QRLMLPYEGN VEQNAMDVKP NTKLLSLDWQ DQGCSDAGKD SFVYLNSLGS WNGMMSNGYG  300
PSTTNPLHFC QISMLRNI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.126630.0bud| fruit| inflorescence
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the vascular tissues and pericycle of primary roots. Detected in the vasculature of the cotyledons, rosette leaves and cauline leaves. In flowers, localized in vasculature of petals, stigma, and stamen filaments, and, to a lower extent, in anthers and carpels. In inflorescence stems, accumulates in the vasculature, particularly in cambium, phloem, and interfascicular parenchyma cells. {ECO:0000269|PubMed:19915089}.
UniprotTISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). Preferentially expressed in the vasculature of all organs, including seedlings, roots, stems, buds, leaves, flowers and siliques, and particularly in the cambium, phloem and interfascicular parenchyma cells of inflorescence stems (PubMed:19915089). {ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3871860.0FQ387186.1 Vitis vinifera clone SS0AEB27YG18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279622.10.0PREDICTED: dof zinc finger protein DOF5.6
SwissprotQ9FM031e-53DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLF6GSR10.0F6GSR1_VITVI; Uncharacterized protein
STRINGVIT_17s0000g08290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.17e-51Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]