PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01005057001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 426aa    MW: 45664.3 Da    PI: 10.0622
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01005057001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.6e-39134193362
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++s
  GSVIVT01005057001 134 SENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNTS 193
                        57899****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-26135190IPR003851Zinc finger, Dof-type
PfamPF027011.7E-32136191IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.544137191IPR003851Zinc finger, Dof-type
PROSITE patternPS013610139175IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MGKPPITSLQ KLLATKIQIH PRIFFLIYFL PHRLREKRWG VFGLLSIHVS TSLYHSHIDL  60
TYTIFKGSKR KKRMIQELLG GGAGLIGGER KITINGGILE ASPSPSPSPS PSSSSSGNTT  120
TVTTAAAATT SSASENLRCP RCDSSNTKFC YYNNYNLTQP RHFCKTCRRY WTKGGALRNV  180
PIGGGCRKNK NTSVSTAVGK SSAGKAKSAV SEIGKSGLGG GFDHEIPSNP ILWASPQNSH  240
LLALLRATQN PNPNPSPISN SVTVKDDGVM IGSHMTSESG VGTGAVNIAR NMGLDHLNQL  300
PSIGLCSSYW RNNQHQTQQH QQNSHHQQQN GFILGEVQNT GIQELYQRLR SSTNYYTDHS  360
PVVLSNAVSS SSSILESAPI AGVLSNAVSS SSSILESAPI AGGELGYWNP TFSWSDLPTT  420
NGAYP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3817350.0FQ381735.1 Vitis vinifera clone SS0ABG86YE06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003635142.10.0PREDICTED: dof zinc finger protein DOF1.1 isoform X2
RefseqXP_019073779.10.0PREDICTED: dof zinc finger protein DOF1.1 isoform X1
TrEMBLF6GYW00.0F6GYW0_VITVI; Uncharacterized protein
STRINGVIT_00s0253g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-32TARGET OF MONOPTEROS 6