PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01003947001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 363aa    MW: 39498.5 Da    PI: 8.8114
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01003947001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.3e-40116176262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++ lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  GSVIVT01003947001 116 PDQVLKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 176
                        68999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-26116174IPR003851Zinc finger, Dof-type
PfamPF027011.4E-33117174IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.432120174IPR003851Zinc finger, Dof-type
PROSITE patternPS013610122158IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MIHQYPTNFP SSATIKKDVY SGSLCSASSV SDHLLSLSLL SLSPPPKLSN PEKHPQLILY  60
PPLSFPSLPI FLFWVFSSSP CIKSLMMSPD DIPANPVSKD ETQGSGGRKT GAHRPPDQVL  120
KCPRCDSPNT KFCYYNNYSL TQPRHFCKTC RRYWTKGGAL RNVPIGGGCR KNKKIKSSSR  180
LSAVSTPCFS IDQPGSSSSL MGFNYPLPSV LKQGESGGFG GAIQDMGSMN VHSSLASSIE  240
SLSSINQDLH WKLQQQRLAM LFGGENQKDS SVSSVPPENQ NQKLQPILFQ NLEISKPEVC  300
AVGNSRKDSA SGNPATEWFF DTYTPVTPTT TNTSTGGNGN DNTNHWNGIQ AWSDLHQYST  360
LP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4668680.0AM466868.2 Vitis vinifera contig VV78X015400.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266518.21e-157PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A438FBL21e-156A0A438FBL2_VITVI; Dof zinc finger protein DOF5.7
STRINGVIT_00s0218g00040.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38000.17e-38DNA binding with one finger 4.7