PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01003546001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 309aa    MW: 34239.7 Da    PI: 7.4683
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01003546001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13e-4371061100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lqq+l+q+++
  GSVIVT01003546001   7 PCAACKLLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVSKLLNELNAAHREDAVNSLAYEAEARLRDPVYGCVGLISILQQRLKQVQN 98 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +l ++k+e
  GSVIVT01003546001  99 DLFTAKKE 106
                        *9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4176107IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSSSNSPCAA CKLLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVSK LLNELNAAHR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ QRLKQVQNDL FTAKKELSAY IGPSAMLPIP  120
QPAGCLPQQH MSNPCSSSQI PYNTPPMLGL ATGPTHGRQL VIREPHQTQQ YQHQQQILEA  180
QQIAEAVAAR EQQEMLRTYE QQRQQQQLLV RFNSGFDAGG TVGASSFNQM TAAISPSLAL  240
GPFDNSYQLE EQQQELHRPQ MLLSTQTQPQ QQQPQLPQQQ QGLEARRVGA GAYIFEVLQL  300
NLSTIFPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4831107114LOB family transfactor Ramosa2.1
5ly0_B2e-4831107114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4866190.0AM486619.2 Vitis vinifera contig VV78X034279.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263109.31e-179PREDICTED: LOB domain-containing protein 36
RefseqXP_019076449.11e-179PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ36e-78LBD36_ARATH; LOB domain-containing protein 36
TrEMBLF6H7Q80.0F6H7Q8_VITVI; Uncharacterized protein
STRINGVIT_07s0197g00020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-71ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]