PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01003431001
Common NameLOC100853966, VIT_07s0191g00180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 281aa    MW: 32121.8 Da    PI: 4.8086
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01003431001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.2e-1957110356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  GSVIVT01003431001  57 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 110
                        456899***********************************************9 PP

2HD-ZIP_I/II126.51.2e-4056148193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy  Lk++y++lk + +++++++e+L +e++
  GSVIVT01003431001  56 EKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGILKANYETLKLNYDAIQHDNEALLKEIR 147
                        69*************************************************************************************99997 PP

        HD-ZIP_I/II  93 e 93 
                        e
  GSVIVT01003431001 148 E 148
                        6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.55E-1944114IPR009057Homeodomain-like
PROSITE profilePS5007117.31352112IPR001356Homeobox domain
SMARTSM003894.0E-1755116IPR001356Homeobox domain
CDDcd000861.74E-1657113No hitNo description
PfamPF000464.0E-1657110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.8E-2059118IPR009057Homeodomain-like
PRINTSPR000317.3E-68392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000317.3E-692108IPR000047Helix-turn-helix motif
PfamPF021834.2E-17112153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MKRLGSSESL GALMAICPTT DEHSPRNNHV YSREFQTMFD GLDEEGCVEE SGQIVEKKRR  60
LSVDQVKALE KNFEVENKLE PERKVKLAQE LGLQPRQVAV WFQNRRARWK TKQLERDYGI  120
LKANYETLKL NYDAIQHDNE ALLKEIRELK SKLNEEKTES NLSVKEELVV SESDEKVKVM  180
EQSETAMVFP DMKDGSSDSD SSAILNEDNS PNAAISSSGV LQNNHHHHLL IPTLGNTQKA  240
YQPQFVKMEE HNFFGADESC NFFSDDQPPT LPWYCPDQWT *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.72950.0bud| cell culture| flower| fruit| inflorescence| leaf| pedicel| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed with a lower level in siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development. {ECO:0000269|PubMed:14623244}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3962620.0FQ396262.1 Vitis vinifera clone SS0AFA10YM11.
GenBankKT2162570.0KT216257.1 Vitis vinifera cultivar Cabernet Sauvignon homodomain-leucine zipper protein ATHB-6-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003632476.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6
SwissprotQ940J14e-77ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A438KQE60.0A0A438KQE6_VITVI; Homeobox-leucine zipper protein ATHB-6
TrEMBLF6HRP50.0F6HRP5_VITVI; Homodomain-leucine zipper protein ATHB-6-like protein
STRINGVIT_07s0191g00180.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.17e-77homeobox protein 6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]