PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01002447001
Common NameLOC100267724, VIT_00s0732g00010, VITISV_022980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 267aa    MW: 29599.4 Da    PI: 6.8776
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01002447001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-19122176256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tkeq   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  GSVIVT01002447001 122 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 176
                        678899***********************************************98 PP

2HD-ZIP_I/II125.13.1e-40122211191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rl+keq++lLEesF+++++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  GSVIVT01002447001 122 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCESLTDENRRLQKELQELK-AL 211
                        69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.18E-19111179IPR009057Homeodomain-like
PROSITE profilePS5007117.637118178IPR001356Homeobox domain
SMARTSM003893.4E-16120182IPR001356Homeobox domain
CDDcd000861.21E-17122179No hitNo description
Gene3DG3DSA:1.10.10.606.5E-18122176IPR009057Homeodomain-like
PfamPF000468.8E-17122176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
SMARTSM003407.0E-25178221IPR003106Leucine zipper, homeobox-associated
PfamPF021832.6E-10178212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGFDDGCNTG LVLGLGFTAT AAALDQTPLK PCTTTDHDQS FEPSLTLSLS GETYQVTGKM  60
DMNKVCEEAA ADLYRQPSPH STVSSFSNAS VKRERDLGSE EVEIERLSSR VSDEDEDGSN  120
GRKKLRLTKE QSALLEESFK QHSTLNPKQK QALAKQLNLR PRQVEVWFQN RRARTKLKQT  180
EVDCEFLKKC CESLTDENRR LQKELQELKA LKLAQPLYMQ LPAATLTMCP SCERIGGVTD  240
GASKSPFTMA PKPHFYNPFT NPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170178RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3820690.0FQ382069.1 Vitis vinifera clone SS0ABG73YE24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271511.20.0PREDICTED: homeobox-leucine zipper protein HAT22 isoform X2
SwissprotP466041e-106HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA5B6260.0A5B626_VITVI; Uncharacterized protein
STRINGVIT_00s0732g00010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.19e-88HD-ZIP family protein
Publications ? help Back to Top
  1. Velasco R, et al.
    A high quality draft consensus sequence of the genome of a heterozygous grapevine variety.
    PLoS ONE, 2007. 2(12): p. e1326
    [PMID:18094749]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  4. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]