PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01002242001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 241aa    MW: 26823.1 Da    PI: 9.7824
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01002242001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.64.1e-361470460
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                       + lkcprCdstntkfCy+nny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr++++ 
  GSVIVT01002242001 14 EPLKCPRCDSTNTKFCYFNNYNKSQPRHFCKSCKRHWTKGGTLRNVPVGGGRKNKRP 70
                       6799**********************************************9877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-221469IPR003851Zinc finger, Dof-type
PfamPF027011.5E-311568IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.6051670IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101854IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MRRQQQQQQQ QQLEPLKCPR CDSTNTKFCY FNNYNKSQPR HFCKSCKRHW TKGGTLRNVP  60
VGGGRKNKRP KTSATATAAA ATPTQQRKSS LALGDHEKSS LSDILYQAFI RPPLSVMQQN  120
SIGSSNGMSM ASIPSLPPNQ NLHFPFRSLS SFDTSPSSIP SSFQPSNVYN YTGEAEAKDG  180
STTACFMPST SGTITQPWQM PAASSVVDTT NYWSWDDIDT FVCYYYLIIA IISNRINYKT  240
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.156050.0flower| fruit| inflorescence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4811220.0AM481122.2 Vitis vinifera contig VV78X236115.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268276.21e-143PREDICTED: dof zinc finger protein DOF1.1
TrEMBLF6HJS11e-142F6HJS1_VITVI; Uncharacterized protein
STRINGVIT_00s0652g00010.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.15e-29DOF zinc finger protein 1