PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01001468001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family bZIP
Protein Properties Length: 364aa    MW: 40860.9 Da    PI: 7.6024
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01001468001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.71.4e-09188232650
                        HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        + rr   NReA r++R++Kka ++ Lee+vk+L   N++L k+l+
  GSVIVT01001468001 188 KVRRPSGNREAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVKKLQ 232
                        5677778**********************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-10183250IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-11187251No hitNo description
CDDcd146868.65E-12188241No hitNo description
PfamPF077163.7E-13188235IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.94E-7188244No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MLPCGTLLKT IIFDSSFIPK NSVQYTTKLL TRNQESSPCQ FDRTHVSALL RFCTKALPFL  60
FCKLAHLKLG FSSAFRNFNV EALCSCLISS AYEESPINWV NLREIIVELS DHVLLSNPNS  120
SSNFQGSTPI DSFLDDFLKN TRTCTHTHTC NPPGPDAAHT HTCYHTHTQV FASEEDEVPN  180
NKEHLISKVR RPSGNREAVR KYREKKKAHT AYLEEEVKKL RLLNQQLVKK LQGQAVLEAE  240
VLRLRSLLLD LRGKIDNELG VFPFQKQCNT TLSFKEGDCG LQSASGAIDP RCEMDLPCFH  300
PHPAVVDCRG NINDMVSAEG HTMDTVEALN YVLTEGICNS DISVTACMKP PMMKIKLFFS  360
CFR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.62900.0bud| fruit| pedicel
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4775630.0AM477563.2 Vitis vinifera contig VV78X030048.70, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003633543.11e-129PREDICTED: basic leucine zipper 23
RefseqXP_010659259.11e-129PREDICTED: basic leucine zipper 23
RefseqXP_010659260.11e-129PREDICTED: basic leucine zipper 23
TrEMBLF6HHY81e-155F6HHY8_VITVI; Uncharacterized protein
STRINGVIT_13s0158g00380.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.19e-28bZIP family protein