PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01001366001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 358aa    MW: 39107.5 Da    PI: 4.917
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01001366001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-17201255256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSVIVT01001366001 201 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 255
                        778899***********************************************98 PP

2HD-ZIP_I/II128.13.6e-41201291192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  GSVIVT01001366001 201 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 291
                        69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.8E-728161IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466893.51E-18194258IPR009057Homeodomain-like
PROSITE profilePS5007116.86197257IPR001356Homeobox domain
SMARTSM003895.4E-15199261IPR001356Homeobox domain
CDDcd000863.11E-16201258No hitNo description
PfamPF000464.7E-15201255IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.3E-17201255IPR009057Homeodomain-like
PROSITE patternPS000270232255IPR017970Homeobox, conserved site
SMARTSM003409.1E-26257300IPR003106Leucine zipper, homeobox-associated
PfamPF021835.4E-11257291IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MELELSLGDA SSKPFAFMEK AHRQVANKGL GFSMGLGLGS AGRDQEEQKI HEVADDDDDD  60
DDGEDDDDGR DQRPSMGLPL QLDLLPLAPV PRNQASHQGL TWPSDNGSSE AGSSGNVGLP  120
ARGLDVNRLP STAVTAAAGE EVEDGAAAEV ESSPNSAASS FQMDFCIYRG GNGGTKRDFE  180
SGEAERTSSR ASDEDDNGLT RKKLRLSKEQ SAFLEESFKE HNTLNPKQKL ALAKQLNLRP  240
RQVEVWFQNR RARTKLKQTE VDCEYLKRCC ETLTEENRRL HKELQELRAL KTSNPFYMQL  300
PATTLTMCPS CERVAATSTA PSAAASTATT HIVLIGVRVF VVSPFLLYQM IHPNTIH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199205TRKKLRL
2249257RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4313180.0AM431318.2 Vitis vinifera contig VV78X241236.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268178.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotP466652e-96HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A438IA750.0A0A438IA75_VITVI; Homeobox-leucine zipper protein HAT14
TrEMBLF6HPT40.0F6HPT4_VITVI; Uncharacterized protein
STRINGVIT_13s0156g00260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-72homeobox from Arabidopsis thaliana