PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun012130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 80aa    MW: 9310.67 Da    PI: 8.9116
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-15779PU_refplantGDBView CDS
gnl|UG|Vun#S45822839PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.5e-11534130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     +++WT++E++ l+ +v+++G+g Wk I + 
        Vun012130  5 KQKWTQDEEDALIAGVEKHGPGKWKNILKD 34
                     79*************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.686153IPR017930Myb domain
SuperFamilySSF466891.96E-11268IPR009057Homeodomain-like
PfamPF002491.3E-8533IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-11536IPR009057Homeodomain-like
CDDcd116601.93E-12650No hitNo description
Gene3DG3DSA:2.60.120.109.3E-75079IPR014710RmlC-like jelly roll fold
PfamPF058993.6E-75078IPR008579Domain of unknown function DUF861, cupin-3
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MGNQKQKWTQ DEEDALIAGV EKHGPGKWKN ILKDPQFAPF LTSHSNIDLK MGMPQGKFPW  60
SYEEKETYYL VEGKVKVWVK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583000.15e-29PREDICTED: telomere repeat-binding factor 4 isoform X2
SwissprotF4I7L18e-21TRB4_ARATH; Telomere repeat-binding factor 4
TrEMBLK7KYV95e-29K7KYV9_SOYBN; Uncharacterized protein
STRINGGLYMA07G00930.12e-28(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17520.14e-22MYB_related family protein