PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun010635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family VOZ
Protein Properties Length: 183aa    MW: 20919.3 Da    PI: 8.4213
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S45888175PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ244.22.3e-75212694217
        VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdek 193
                elfd+++legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp++ fewhlyeyei+++da+alyrlelklvd+k
  Vun010635   2 ELFDICVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNLFEWHLYEYEISKCDACALYRLELKLVDGK 101
                9*************************************************************************************************** PP

        VOZ 194 ksakgk.vskdsladlqkklgrlta 217
                ks+k+k ++ ds+adlqk++g+l+a
  Vun010635 102 KSSKTKiITGDSVADLQKHMGSLSA 126
                ******5578************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
XELFDICVLE GETIREWLFF DKPRRAFESG NRKQRSLPDY SGRGWHESRK QVMNEFGGLK  60
RSYYMDPQPL NLFEWHLYEY EISKCDACAL YRLELKLVDG KKSSKTKIIT GDSVADLQKH  120
MGSLSAEFHS DSNKRSAKGS RTKLGIGGGV YSASNRPALL NAPYQYGLTA PYDFVVDNTS  180
DYM
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027933409.11e-131transcription factor VOZ1-like
SwissprotQ9SGQ04e-76VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A4D6KJV41e-130A0A4D6KJV4_VIGUN; Uncharacterized protein
STRINGXP_007148099.11e-127(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.22e-78vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]