PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun010348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 195aa    MW: 22054.9 Da    PI: 10.2472
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S50218249PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-52141391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g++++l  +i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++v
  Vun010348  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-PIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRKV 111
                79**************************99.88***************7777799***********************************9999.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg+kt+W+mheyrl
  Vun010348 112 GIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                **************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6710163IPR003441NAC domain
PROSITE profilePS5100560.16114162IPR003441NAC domain
PfamPF023657.4E-2715139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MGVPEKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLPIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLL DSTRKNTGTK LDDWVLCRIY KKNSSAQKAV QNGIVSSRGH  180
TQYSNGSSSS SSSHX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-11011687174NAC domain-containing protein 19
3swm_B1e-11011687174NAC domain-containing protein 19
3swm_C1e-11011687174NAC domain-containing protein 19
3swm_D1e-11011687174NAC domain-containing protein 19
3swp_A1e-11011687174NAC domain-containing protein 19
3swp_B1e-11011687174NAC domain-containing protein 19
3swp_C1e-11011687174NAC domain-containing protein 19
3swp_D1e-11011687174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by high salinity. Slightly up-regulated by drought, abscisic acid (ABA) and jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:15319476}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027929469.11e-140NAC domain-containing protein 72
SwissprotQ9LDY81e-112NAC55_ARATH; NAC domain-containing protein 55
TrEMBLA0A4D6NAT71e-139A0A4D6NAT7_VIGUN; Uncharacterized protein
STRINGXP_007149614.11e-134(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.11e-113NAC domain containing protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zheng XY, et al.
    Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation.
    Cell Host Microbe, 2012. 11(6): p. 587-96
    [PMID:22704619]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  5. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  6. Gimenez-Ibanez S, et al.
    JAZ2 controls stomata dynamics during bacterial invasion.
    New Phytol., 2017. 213(3): p. 1378-1392
    [PMID:28005270]
  7. Hickman R, et al.
    Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network.
    Plant Cell, 2017. 29(9): p. 2086-2105
    [PMID:28827376]
  8. Fu Y,Ma H,Chen S,Gu T,Gong J
    Control of proline accumulation under drought via a novel pathway comprising the histone methylase CAU1 and the transcription factor ANAC055.
    J. Exp. Bot., 2018. 69(3): p. 579-588
    [PMID:29253181]