PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008959
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27853.2 Da    PI: 4.3353
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S45793955PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94.2e-192881356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               k+++++ +q+++Le+ Fe ++++  +++ +LA++lgL+ rqV vWFqNrRa++k
  Vun008959 28 KKRRLSVDQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWK 81
               566899***********************************************9 PP

2HD-ZIP_I/II130.94.8e-4227119193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls +qvk+LE++Fe e+kLep+rKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++yd+lk + ++L++++e+L +e+ke
    Vun008959  27 EKKRRLSVDQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDSLKLNYDTLQQDNEALLKEIKE 119
                  69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-191385IPR009057Homeodomain-like
PROSITE profilePS5007117.3292383IPR001356Homeobox domain
SMARTSM003898.6E-182687IPR001356Homeobox domain
PfamPF000463.1E-162881IPR001356Homeobox domain
CDDcd000869.37E-172884No hitNo description
Gene3DG3DSA:1.10.10.604.2E-203090IPR009057Homeodomain-like
PRINTSPR000316.0E-65463IPR000047Helix-turn-helix motif
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PRINTSPR000316.0E-66379IPR000047Helix-turn-helix motif
PfamPF021833.6E-1783124IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
XYGREFQSML EGLDDEGCVE EPGHHAEKKR RLSVDQVKAL EKNFEVENKL EPDRKVKLAQ  60
ELGLQPRQVA VWFQNRRARW KTKQLERDYG VLKANYDSLK LNYDTLQQDN EALLKEIKEL  120
KSRLLLQEES NTESDVSVKE EMITLQDSNP LCETAIPGSE CFNKSDEVLG GFKDGSSDSD  180
SSAILNEENA NNNDNSPNNA TISSSGVMQS QSFLSSLLDE LFPVPETVSA VREDGEHNFL  240
SADERAX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17583RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510048.11e-130PREDICTED: homeobox-leucine zipper protein ATHB-6-like
SwissprotQ940J13e-63ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A0L9TJK41e-131A0A0L9TJK4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QYJ61e-131A0A0S3QYJ6_PHAAN; Uncharacterized protein
STRINGGLYMA05G30940.11e-112(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-61homeobox protein 16