PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 266aa    MW: 30712.5 Da    PI: 9.7951
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-5219PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.27.9e-50261761128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.........................kvka...eekewyfFskrdkkyatgk 72 
                lppGfrFhPtd+elv++yL++k++g+++ +  +i+evd+yk++Pw+Lp                          +      +ekewyfFs+rd+ky++g+
  Vun008488  26 LPPGFRFHPTDDELVNHYLCRKCAGQPIAV-PIIREVDLYKFDPWQLPGpfnficlsynfnffiqfthhdilhaE--IgfyGEKEWYFFSPRDRKYPNGS 122
                79**************************99.88**************96679**********9999888776551..1556889**************** PP

        NAM  73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                r+nra+ sgyWkatg dk++ +   ++ g+kk Lvfy+g+apkgekt+W+mheyrl
  Vun008488 123 RPNRAAGSGYWKATGADKPIGK--PKALGIKKALVFYSGKAPKGEKTNWIMHEYRL 176
                ********************98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5520203IPR003441NAC domain
PROSITE profilePS5100557.6426203IPR003441NAC domain
PfamPF023659.2E-2827176IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
XPTTTTTTAT THKRGEEKQM KSELELPPGF RFHPTDDELV NHYLCRKCAG QPIAVPIIRE  60
VDLYKFDPWQ LPGPFNFICL SYNFNFFIQF THHDILHAEI GFYGEKEWYF FSPRDRKYPN  120
GSRPNRAAGS GYWKATGADK PIGKPKALGI KKALVFYSGK APKGEKTNWI MHEYRLANVD  180
RSASKKNNNL RLDDWVLCRI YNKKGKIEKY NTGAPKSETG VVYNFEHETK PVIEKLRNEQ  240
LSTESSDSMQ RLQTESSGSG QWFRRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-78172096174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027942546.11e-154NAC domain-containing protein 2-like
SwissprotQ390132e-98NAC2_ARATH; NAC domain-containing protein 2
SwissprotQ7F2L32e-98NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLA0A4D6NPB61e-154A0A4D6NPB6_VIGUN; Uncharacterized protein
STRINGXP_007137752.11e-139(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-100NAC family protein
Publications ? help Back to Top
  1. Xiong L,Lee MW,Qi M,Yang Y
    Identification of defense-related rice genes by suppression subtractive hybridization and differential screening.
    Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92
    [PMID:11332734]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Ohnishi T, et al.
    OsNAC6, a member of the NAC gene family, is induced by various stresses in rice.
    Genes Genet. Syst., 2005. 80(2): p. 135-9
    [PMID:16172526]
  4. Hu H, et al.
    Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice.
    Plant Mol. Biol., 2008. 67(1-2): p. 169-81
    [PMID:18273684]
  5. Kim MJ, et al.
    Quadruple 9-mer-based protein binding microarray with DsRed fusion protein.
    BMC Mol. Biol., 2009. 10: p. 91
    [PMID:19761621]
  6. Chung PJ,Kim JK
    Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth.
    Plant Signal Behav, 2009. 4(7): p. 675-7
    [PMID:19820307]
  7. Peng HF, et al.
    Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.).
    Theor. Appl. Genet., 2010. 120(5): p. 1013-20
    [PMID:20012261]
  8. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  9. Kim MJ, et al.
    Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein.
    Methods Mol. Biol., 2012. 786: p. 65-77
    [PMID:21938620]
  10. Gupta SK, et al.
    The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice.
    J. Exp. Bot., 2012. 63(2): p. 757-72
    [PMID:22058403]
  11. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  12. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  13. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  14. Nakashima K, et al.
    Comparative functional analysis of six drought-responsive promoters in transgenic rice.
    Planta, 2014. 239(1): p. 47-60
    [PMID:24062085]
  15. Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice.
    Rice (N Y), 2012. 5(1): p. 6
    [PMID:24764506]
  16. Qian B, et al.
    Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+).
    J. Plant Physiol., 2015. 175: p. 9-20
    [PMID:25460871]
  17. Shiriga K, et al.
    Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize.
    Meta Gene, 2014. 2: p. 407-17
    [PMID:25606426]
  18. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  19. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  20. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  21. Farooq MA,Detterbeck A,Clemens S,Dietz KJ
    Silicon-induced reversibility of cadmium toxicity in rice.
    J. Exp. Bot., 2016. 67(11): p. 3573-85
    [PMID:27122572]
  22. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  23. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  24. Lee DK, et al.
    The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance.
    Plant Biotechnol. J., 2017. 15(6): p. 754-764
    [PMID:27892643]
  25. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]