PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008419
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family BES1
Protein Properties Length: 269aa    MW: 29723.6 Da    PI: 11.2887
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-238PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822223.83.5e-69722161148
     DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                g++gr+ptwkErEnnkrRERrRRaiaakiy+GLRaqGnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+k+++ +e++g+  ++s +ss+q s++s
  Vun008419  72 GSTGRMPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKRPTGSEIGGTPPNISACSSIQPSPQS 171
                589*************************************************************************9*********************** PP

     DUF822 101 salaspvesysaspksssfpspssldsislasaasllpvlsvlslvss 148
                s+++spv+sy+asp+sssfpsp+++d ++++    l+p++++ +++++
  Vun008419 172 SSFPSPVPSYHASPTSSSFPSPTRIDANPSS---FLIPFIRNITSIPA 216
                ***************************9885...78888888776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.9E-6574198IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
GRENRRAQEK IQEKQSFHFS FFICSSPKKL ESNSLRFCYC HTHGTSTTPL LFVTHRGKQN  60
GLRLAGTMTG GGSTGRMPTW KERENNKRRE RRRRAIAAKI YTGLRAQGNY KLPKHCDNNE  120
VLKALCAEAG WIVEEDGTTY RKGCKRPTGS EIGGTPPNIS ACSSIQPSPQ SSSFPSPVPS  180
YHASPTSSSF PSPTRIDANP SSFLIPFIRN ITSIPANLPP LRYPTAPLSP HLFPLPGPPS  240
ARRTSIPSPR LLPPPSFRTR PSALARTRX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349751.11e-65PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ94A433e-50BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLA0A0L9URF17e-66A0A0L9URF1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T5D58e-66A0A0S3T5D5_PHAAN; Uncharacterized protein
STRINGGLYMA01G38450.15e-64(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36780.18e-38BES1/BZR1 homolog 2