PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 288aa    MW: 31520.8 Da    PI: 9.4715
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-26654PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73e-142569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
        Vun008084 25 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 69
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-171975IPR009057Homeodomain-like
PROSITE profilePS5129416.2912074IPR017930Myb domain
TIGRFAMsTIGR015578.4E-192372IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.6E-72375IPR009057Homeodomain-like
SMARTSM007171.1E-112472IPR001005SANT/Myb domain
PfamPF002496.7E-122569IPR001005SANT/Myb domain
CDDcd001672.08E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAAAVAASDG SGKKVRKPYT ITKSRESWTE EEHDKFLEAL QLFDRDWKKI EDFVGSKTVI  60
QIRSHAQKYF LKVQKNGTVA HVPPPRPKRK AAHPYPQKAS KNVLVPLPAS IGYASSTNML  120
APGFATWDET SLLMNTGASK SMTCQDEPNN IRGNEADIGS KGMPKITNSS LSGVRNSTRT  180
LPSSEIPKQG KQAPVLHGLP DFAEVYSFIG SVFDPDTNDH VQKLKEMDPI NFETVLLLMR  240
NLTVNLSSPD FEPIKKALST YDVNGMAVGV GTGIDVKKNT NDLSCQTA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491922.10.0PREDICTED: protein REVEILLE 8-like isoform X1
RefseqXP_014491921.10.0PREDICTED: protein REVEILLE 8-like isoform X1
SwissprotQ8RWU31e-135RVE8_ARATH; Protein REVEILLE 8
TrEMBLV7BG080.0V7BG08_PHAVU; Uncharacterized protein
STRINGGLYMA13G19910.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-120MYB_related family protein