PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun005544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 182aa    MW: 20784.1 Da    PI: 7.5098
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-22386PU_refplantGDBView CDS
gnl|UG|Vun#S45832891PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1984137356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq++ Le+ F +++++  e++ +LAk+lgL+ rqV +WFqNrRa++k
  Vun005544  84 KKRRLSVEQVQFLEKSFDEENKLEPERKIRLAKELGLQPRQVAIWFQNRRARWK 137
                56689************************************************9 PP

2HD-ZIP_I/II113.81e-3683165184
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                  ekkrrls eqv++LE+sF+ee+kLeperK +la+eLglqprqva+WFqnrRAR+ktk++Ekdy++L++a+  ++++ + L +e+
    Vun005544  83 EKKRRLSVEQVQFLEKSFDEENKLEPERKIRLAKELGLQPRQVAIWFQNRRARWKTKRMEKDYDSLQHAIM-ISSQFDDLLREK 165
                  69****************************************************************99875.455555554443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-2070139IPR009057Homeodomain-like
PROSITE profilePS5007117.57279139IPR001356Homeobox domain
SMARTSM003893.0E-1982143IPR001356Homeobox domain
CDDcd000862.21E-1784140No hitNo description
PfamPF000465.5E-1784137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-2086147IPR009057Homeodomain-like
PRINTSPR000317.8E-6110119IPR000047Helix-turn-helix motif
PROSITE patternPS000270114137IPR017970Homeobox, conserved site
PRINTSPR000317.8E-6119135IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MVAGTVFSAA SNLTTLLPNQ TPPSASQPLD SLFHSSSSSP FLGSRSIVSF GDVQGGKGCN  60
GSFFLPYDEN GDEDTDEYFH QPEKKRRLSV EQVQFLEKSF DEENKLEPER KIRLAKELGL  120
QPRQVAIWFQ NRRARWKTKR MEKDYDSLQH AIMISSQFDD LLREKISSKL STKLSEKCLE  180
RX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014522235.19e-99PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC035e-34ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0L9UCK91e-101A0A0L9UCK9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RG261e-101A0A0S3RG26_PHAAN; Uncharacterized protein
STRINGGLYMA06G20230.12e-89(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-34homeobox 1