PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun004812
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 209aa    MW: 23542.9 Da    PI: 6.6722
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-11156PU_refplantGDBView CDS
gnl|UG|Vun#S45870685PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.8e-19133187256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Vun004812 133 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKQLGLLPRQVEVWFQNRRARTK 187
                788899***********************************************98 PP

2HD-ZIP_I/II116.81.2e-37133208176
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkee 76 
                  +kk+rlsk+q+++LEesF+e+++L+p++K +la++Lgl prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+ee
    Vun004812 133 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKQLGLLPRQVEVWFQNRRARTKLKQTEVDCEVLKRCCENLTEE 208
                  69***********************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.6E-302107IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.6E-18106190IPR009057Homeodomain-like
SuperFamilySSF466892.65E-18121190IPR009057Homeodomain-like
PROSITE profilePS5007117.184129189IPR001356Homeobox domain
SMARTSM003891.2E-16131193IPR001356Homeobox domain
PfamPF000462.7E-16133187IPR001356Homeobox domain
CDDcd000861.18E-15133190No hitNo description
PRINTSPR000311.7E-5160169IPR000047Helix-turn-helix motif
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PRINTSPR000311.7E-5169185IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MMVQKEDLGL SLSLNFRHNI PNPQHLTLIS SSTHSSSPSP SPSNPFKPSW NDAFDRNSDT  60
CRGETRSFLR GIDVNRLPSG VDMEEEAGVS SPNSTVSSVS GKRSEREPNG EEHDMNRACS  120
RGISDEEDGE TSRKKLRLSK DQSAILEESF KEHNTLNPKQ KLALAKQLGL LPRQVEVWFQ  180
NRRARTKLKQ TEVDCEVLKR CCENLTEEX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131137SRKKLRL
2181189RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509478.11e-138PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466005e-75HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLA0A0L9TPS01e-134A0A0L9TPS0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R5H11e-134A0A0S3R5H1_PHAAN; Uncharacterized protein
STRINGGLYMA05G04990.11e-120(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-60homeobox protein 2