PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun004525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 220aa    MW: 24934.9 Da    PI: 8.676
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-26863PU_refplantGDBView CDS
gnl|UG|Vun#S45926804PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.41e-51141401128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+  ++    +i+evd+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++v
  Vun004525  14 LPPGFRFYPTDEELLVQYLCRKVAXAPFFSLPIIAEVDLYKFDPWVLPAKAVFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITT-EGRKV 112
                79*************************888799***************8777899*************************************99.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg+kt+W+mheyr+
  Vun004525 113 GIKKALVFYVGKAPKGSKTNWIMHEYRV 140
                **************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-6310166IPR003441NAC domain
PROSITE profilePS5100559.78314165IPR003441NAC domain
PfamPF023651.7E-2615140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MGVPERDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAXAP FFSLPIIAEV DLYKFDPWVL  60
PAKAVFGEKE WYFFSPRDRK YPNGSRPNRV AGSGYWKATG TDKVITTEGR KVGIKKALVF  120
YVGKAPKGSK TNWIMHEYRV LDSSRKNNLG TTKLDDWVLC RIYKKNSSSQ KVEANLWAKE  180
CSNGSSPSSS SHVEDMVESF LEIDDQCFNF SGCGLDQINX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10311714171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10311714171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10311714171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10311714171NO APICAL MERISTEM PROTEIN
4dul_A1e-10311714171NAC domain-containing protein 19
4dul_B1e-10311714171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027908969.11e-142NAC domain-containing protein 72-like
SwissprotA0A3Q7HH641e-107JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A4D6LF171e-141A0A4D6LF17_VIGUN; Uncharacterized protein
STRINGXP_007133057.11e-132(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.11e-106NAC domain containing protein 3
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]