PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun003442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 257aa    MW: 29444.4 Da    PI: 7.4381
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-19234PU_refplantGDBView CDS
gnl|UG|Vun#S45799419PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.5e-5391341128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFh tdeel+v+yL++++++k++++ ++i+evd+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nrat sgyWkatg+dk+++s +++lv
  Vun003442   9 LPPGFRFHSTDEELIVYYLCNQATSKPCPA-SIIPEVDLYKFDPWELPDKTEFGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYS-GSKLV 106
                79****************************.89***************99999*****************************************.9**** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk+Lvfykgr pkg ktdW+mheyrl
  Vun003442 107 GVKKSLVFYKGRPPKGDKTDWIMHEYRL 134
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-655161IPR003441NAC domain
PROSITE profilePS5100560.3419161IPR003441NAC domain
PfamPF023651.7E-2510134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDATTSSELP PGFRFHSTDE ELIVYYLCNQ ATSKPCPASI IPEVDLYKFD PWELPDKTEF  60
GENEWYFFSP RDRKYPNGVR PNRATVSGYW KATGTDKAIY SGSKLVGVKK SLVFYKGRPP  120
KGDKTDWIMH EYRLAESKQS ANRKIGSMRL DDWVLCRIYK KENMGKTLEH KEAHPKVQIT  180
NLIAENNDEQ KTMMNLPRTW SLTYLLDMNY LGPILSDGSY CSTFDFQISN ANIGIDPLVK  240
SQPVEMGNNY VADSGKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-72216310167NO APICAL MERISTEM PROTEIN
1ut4_B6e-72216310167NO APICAL MERISTEM PROTEIN
1ut7_A6e-72216310167NO APICAL MERISTEM PROTEIN
1ut7_B6e-72216310167NO APICAL MERISTEM PROTEIN
4dul_A6e-72216310167NAC domain-containing protein 19
4dul_B6e-72216310167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027916523.10.0NAC transcription factor 29-like
SwissprotO492551e-108NAC29_ARATH; NAC transcription factor 29
TrEMBLA0A4D6L2230.0A0A4D6L223_VIGUN; Uncharacterized protein
STRINGXP_007158644.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-110NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Zhang K,Gan SS
    An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves.
    Plant Physiol., 2012. 158(2): p. 961-9
    [PMID:22184656]
  2. Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS
    Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12
    [PMID:23959884]
  3. Shinozaki Y, et al.
    Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span.
    J. Plant Physiol., 2014. 171(8): p. 633-8
    [PMID:24709156]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  6. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]