PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun003241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 266aa    MW: 30727.3 Da    PI: 9.3642
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-4881PU_refplantGDBView CDS
gnl|UG|Vun#S45827307PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-16110154147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
        Vun003241 110 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 154
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-16104157IPR009057Homeodomain-like
PROSITE profilePS5129421.527105159IPR017930Myb domain
TIGRFAMsTIGR015571.8E-17108157IPR006447Myb domain, plants
SMARTSM007177.3E-13109157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-9110150IPR009057Homeodomain-like
PfamPF002497.5E-14110153IPR001005SANT/Myb domain
CDDcd001671.65E-9112155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MALFQVKTCK MEVFLDILIV VASAFERFWR CGVLFVASPC HQLLLIFTTT ALPFAVFHVP  60
KNERRYSFYP LLVREDLKQP SCTRPLMDAY SSGEEVVIKT RKPYTITKQR ERWTEEEHNR  120
FLEALKLYGR AWQRIEEHIG TKTAVQIRSH AQKFFSKGQL AFQALFSREV LPQSFSPPHA  180
LVNADNQIHS MNKQNTEYKD EGVQKSLSFV KDNDDEEGLL SMGLGQGKQK SCRTGFKPYK  240
RCSVEAKETN QGEEKGPKRI RLNEEA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499065.15e-54PREDICTED: protein LHY-like isoform X1
RefseqXP_014499066.15e-54PREDICTED: protein LHY-like isoform X1
RefseqXP_014499067.15e-54PREDICTED: protein LHY-like isoform X2
SwissprotP929735e-37CCA1_ARATH; Protein CCA1
TrEMBLA0A0S3RIB85e-52A0A0S3RIB8_PHAAN; Uncharacterized protein
STRINGGLYMA19G45030.11e-41(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.13e-38circadian clock associated 1