PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun001992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 327aa    MW: 37056.9 Da    PI: 4.5768
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-1628PU_refplantGDBView CDS
gnl|UG|Vun#S45799258PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.9e-1986139356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t+eq++ Le+ Fe ++++  e++ +LAk+lgL+ rqV +WFqNrRa+ k
  Vun001992  86 KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFK 139
                56689***********************************************98 PP

2HD-ZIP_I/II1314.6e-4286177293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  kkrrl++eqv++LE++Fe e+kLeperKv+la+eLglqprqva+WFqnrRAR+ktkqlEkdy +Lk++yd+lk + e+L +e+++L++e+++
    Vun001992  86 KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEKDYGTLKASYDRLKGDYESLVQENDKLKAEVNS 177
                  9**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-1977143IPR009057Homeodomain-like
PROSITE profilePS5007117.37881141IPR001356Homeobox domain
SMARTSM003891.5E-1783145IPR001356Homeobox domain
CDDcd000861.17E-1784142No hitNo description
PfamPF000462.5E-1686139IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-1988148IPR009057Homeodomain-like
PRINTSPR000315.1E-6112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000315.1E-6121137IPR000047Helix-turn-helix motif
PfamPF021839.5E-18141182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAGGKLHAAS TMSLLLQNER LPCSSEVLES LWAHTSNPAS FQGSKSMVDF ENVSGGRVTD  60
RPFFQALEKE ENCDDDYEGC FHQPGKKRRL TSEQVQFLER NFEVENKLEP ERKVQLAKEL  120
GLQPRQVAIW FQNRRARFKT KQLEKDYGTL KASYDRLKGD YESLVQENDK LKAEVNSLES  180
KLILRDKEKE NSDDKSSPDA VNSPHKEPMD LISNSTSENG TKVSLPIMVT CKQEDANSAK  240
SDVLDSDSPH CTDGNHPSSF VEPADSSHAF EPDHSDFSQD EEDNLSETLL TLPCLPKVEE  300
PCYDHPPENP CNFGFHVEDQ TFCFWPY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARFKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157405.10.0hypothetical protein PHAVU_002G067200g
TrEMBLA0A0L9VNR30.0A0A0L9VNR3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3400.0A0A0S3T340_PHAAN; Uncharacterized protein
STRINGGLYMA01G04890.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-47homeobox 1