PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun000259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 303aa    MW: 32559.4 Da    PI: 9.8969
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-29839PU_refplantGDBView CDS
gnl|UG|Vun#S45864061PU_unrefUnigeneView CDS
gnl|UG|Vun#S45935525PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.4e-1493137347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
        Vun000259  93 PWTEEEHRLFLLGLHKVGKGDWRGISRNFVKTRTPTQVASHAQKY 137
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.631520IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.55486142IPR017930Myb domain
SuperFamilySSF466898.61E-1788141IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1689140IPR006447Myb domain, plants
SMARTSM007171.2E-1090140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-1192137IPR009057Homeodomain-like
CDDcd001679.78E-1093138No hitNo description
PfamPF002492.3E-1193137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSRTCSQCGN NGHNSRTCTD GGAAVSGGAS PRESGFMLFG VRVTEGISSF RKSASMNNLS  60
QYDADSNTAD AGYASDDVVH ASGRTRERKR GVPWTEEEHR LFLLGLHKVG KGDWRGISRN  120
FVKTRTPTQV ASHAQKYFLR RHNQNRRRRR SSLFDITTDT VMESSTIMEE EQVQQETAAA  180
PIPAAYPPSH YGCFPGAGFP MSLSPVVLPA TGERLAKPIR PTPILPVPPS SKMASLNLKE  240
KASPTNLIEP LPLSLNLPSP TPRSQDQSPA NSDHSSPSSS SSTFQAISAG KFSGGGDSII  300
SVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490537.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B07e-50MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0S3T2U30.0A0A0S3T2U3_PHAAN; Uncharacterized protein
STRINGGLYMA02G03020.11e-160(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.25e-77MYB_related family protein