PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi11g10230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 419aa    MW: 47584.7 Da    PI: 7.9839
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi11g10230.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.3e-5211281128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      + pGfrFhPtdeelv +yLk+k++++++++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s
  Vradi11g10230.1   1 MLPGFRFHPTDEELVGFYLKRKIQQRPFTI-ELIKQLDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYS 93 
                      579**************************9.89***************8888999*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  Vradi11g10230.1  94 SeGSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 128
                      956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.0741172IPR003441NAC domain
SuperFamilySSF1019412.22E-562172IPR003441NAC domain
PfamPF023651.6E-253128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MLPGFRFHPT DEELVGFYLK RKIQQRPFTI ELIKQLDIYK YDPWDLPKLA TTGEKEWYFY  60
CPRDRKYRNS ARPNRVTGAG FWKATGTDRP IYSSEGSKCI GLKKSLVFYK GRAAKGVKTD  120
WMMHEFRLPS LTDSLSPKCF NFQMFVISSF IDFFSLFLIM QESWAICRIF KKTNATAQRA  180
LSQSWVSSLP ETRTSDHIQT KDQNSMQFCS DISFTKKTTL ASHYFTNNYN DAQPLTPNSS  240
TTLCPLDVAS YKSIINPLLY KAFDHFPISN GDLSTSFLFS SPFDTSSDGN TNAKSTMDVS  300
SMLLNMSSSV VGDFNKTSED NTNANTSFGG LQEHGAYPIP FLREMQSTFG EQQYDNIHAL  360
VKGPNVNMPR VDDQELETVR SIGFPFNIGD AWKSNLLWDT SSFPCDLSST YSITKCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-51317919171NO APICAL MERISTEM PROTEIN
1ut4_B3e-51317919171NO APICAL MERISTEM PROTEIN
1ut7_A3e-51317919171NO APICAL MERISTEM PROTEIN
1ut7_B3e-51317919171NO APICAL MERISTEM PROTEIN
4dul_A3e-51317919171NAC domain-containing protein 19
4dul_B3e-51317919171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi11g10230.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520507.10.0protein FEZ
SwissprotQ9ZVH01e-100FEZ_ARATH; Protein FEZ
TrEMBLA0A1S3VQN90.0A0A1S3VQN9_VIGRR; protein FEZ
STRINGXP_007157629.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-101NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]