PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi11g07090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 342aa    MW: 39753.5 Da    PI: 6.6528
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi11g07090.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.31.1e-26203252352
           RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ++isl+dl +yF +pi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  Vradi11g07090.1 203 AKISLSDLVQYFGMPIVEASRNLNVGLTVLKRKCREFGIPRWPHRKIKSL 252
                      589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.963187273IPR003035RWP-RK domain
PfamPF020426.1E-22205252IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MRSLHVYRQG DEEERAVERE FVFSECGSYV EMQATPILKF VKSHVSRVFQ GYKNGVWLCI  60
FAYHADHTPR FYRIPPLLLV SRNPKLQMVP NLLHDLHVIY KLDRKEEDKD TTLESKGEEC  120
QGNSDNFQPS EKVFPVLDQD LNYLPYEEDE SELLENETDV ESSPVLQYHE VQVFTIIDYI  180
VVMRSEFAGL LGKKKRAPSD LVAKISLSDL VQYFGMPIVE ASRNLNVGLT VLKRKCREFG  240
IPRWPHRKIK SLDSLIHDLQ VLLALPVEHM QEEAKSQELE DMEAAMAVAK RQRMLECEKE  300
NIEKKPFMDI QTETKRFRQD VFKRRHRARA VGKHNSTVSN T*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi11g07090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-129AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520328.10.0protein RKD5 isoform X1
TrEMBLA0A1S3VPK50.0A0A1S3VPK5_VIGRR; protein RKD5 isoform X1
STRINGXP_007157999.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-69RWP-RK domain-containing protein