PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi11g06240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 338aa    MW: 38766.4 Da    PI: 4.8318
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi11g06240.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.92.8e-5591381129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+e+d+y++ePwdL+      ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+
  Vradi11g06240.1   9 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIREIDLYRIEPWDLQDrcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKA 101
                      69****************************.9***************953432234667*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      v++ k +l+g++ktLvfykgrap+g+k+dW+mheyrle
  Vradi11g06240.1 102 VYD-KAKLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 138
                      ***.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-605158IPR003441NAC domain
PROSITE profilePS5100559.4959158IPR003441NAC domain
PfamPF023657.3E-2910137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MMESMESCVP PGFRFHPTDE ELVGYYLRKK VASQKIDLDV IREIDLYRIE PWDLQDRCRI  60
GYEEQNEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK AVYDKAKLIG MRKTLVFYKG  120
RAPNGQKSDW IMHEYRLESD ENGPPQEEGW VVCRAFKKKT TGQTKTIEGW DSSYFFEEGS  180
GVSTVADPID LISRQSQSFL SQNFLCKQEI EADNLSCMLQ DPFVQLPQLE SPSLPLVKRP  240
STVSLVSDNN EDEDIQNRLS NNNTKKVTDW RALDKFVASQ LSQEDTLETN GLSSFEPHDS  300
HDMALLLLQS SRDEGNRLSP FLNTNSDCDI GICVFEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-51916320173NAC domain-containing protein 19
3swm_B2e-51916320173NAC domain-containing protein 19
3swm_C2e-51916320173NAC domain-containing protein 19
3swm_D2e-51916320173NAC domain-containing protein 19
3swp_A2e-51916320173NAC domain-containing protein 19
3swp_B2e-51916320173NAC domain-containing protein 19
3swp_C2e-51916320173NAC domain-containing protein 19
3swp_D2e-51916320173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi11g06240.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520143.10.0NAC domain-containing protein 37
RefseqXP_014520144.10.0NAC domain-containing protein 37
SwissprotQ9SL411e-163NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A1S3VP260.0A0A1S3VP26_VIGRR; NAC domain-containing protein 37
STRINGXP_007157940.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-154vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]