PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi11g03840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 133aa    MW: 15181.8 Da    PI: 10.0561
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi11g03840.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.87.7e-1312412756
                     HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox 27 aeereeLAkklgLterqVkvWFqNrRakek 56
                     +++++ LA++l+L  rqV vWFqNrRa+ k
  Vradi11g03840.1 12 EKMKQALARQLNLRPRQVEVWFQNRRARTK 41
                     57899***********************98 PP

2HD-ZIP_I/II91.78.3e-3013762791
      HD-ZIP_I/II 27 erKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
                     + K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Vradi11g03840.1 13 KMKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELK-AL 76
                     6799*********************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0039347IPR001356Homeobox domain
CDDcd000861.93E-9444No hitNo description
PfamPF000462.7E-101241IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-111241IPR009057Homeodomain-like
SuperFamilySSF466891.03E-101351IPR009057Homeodomain-like
PROSITE profilePS5007112.2121543IPR001356Homeobox domain
PROSITE patternPS0002701841IPR017970Homeobox, conserved site
SMARTSM003401.1E-244386IPR003106Leucine zipper, homeobox-associated
PfamPF021832.6E-104377IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MCGKKYKMNG YEKMKQALAR QLNLRPRQVE VWFQNRRART KLKQTEVDCE FLKKCCETLT  60
DENRRLKKEL QELKALKLAQ PLYMPMPAAT LTMCPSCERL GGVSDNASNK SPFSMAPKTH  120
FYNPFANPSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13543RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi11g03840.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-156AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014519906.13e-83homeobox-leucine zipper protein HAT22 isoform X2
RefseqXP_017426533.13e-83PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466042e-63HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0L9UQV66e-82A0A0L9UQV6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T5V16e-82A0A0S3T5V1_PHAAN; Uncharacterized protein
TrEMBLA0A1S3VNF08e-82A0A1S3VNF0_VIGRR; homeobox-leucine zipper protein HAT22 isoform X2
STRINGGLYMA11G04840.19e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.14e-55HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]