PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi10g04910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YC
Protein Properties Length: 197aa    MW: 21580.7 Da    PI: 5.9164
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi10g04910.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC150.72.9e-473911921101
            NF-YC  21 lPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                      lPlarikki+kadedv+misaeaPv++++ace+fileltlrsw+h+eenkrrtl+k+diaaa+trtdifdflvdivpr++l
  Vradi10g04910.1  39 LPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 119
                      9*****************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471138.05E-2937110IPR009072Histone-fold
PfamPF008081.1E-2139101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.105.7E-3839116IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MDHQGHGQNP SMGVVGSGAQ LPYGSNPYQQ GQITGPPGLP LARIKKIMKA DEDVRMISAE  60
APVIFARACE MFILELTLRS WNHTEENKRR TLQKNDIAAA ITRTDIFDFL VDIVPREDLK  120
DEVLASIPRG TMPVGGPADA LPYCYMPPQH APQVGTGGVI MGKPVMDPNM YAQQSHPYMA  180
PQMWPQPPDQ HNQAPD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_B5e-39391162097NF-YC
4awl_C5e-39391161794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4csr_B5e-39391161794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18894RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006604828.11e-111PREDICTED: nuclear transcription factor Y subunit C-3
RefseqXP_014627411.11e-111PREDICTED: nuclear transcription factor Y subunit C-3
SwissprotQ8L4B23e-68NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLI1NC071e-111I1NC07_SOYBN; Uncharacterized protein
STRINGGLYMA19G42460.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.42e-69nuclear factor Y, subunit C9